SLC47A1 Rabbit pAb (APR21116N)

• Background:

  This gene is located within the Smith-Magenis syndrome region on chromosome 17. It encodes a protein of unknown function.

• Synonyms:

  SLC47A1; MATE1

• Gene ID:

  55244

• UniProt:

  Q96FL8

• Cellular Locus:

  Cell membrane, Multi-pass membrane protein

• Applications:

  WB (Rattus norvegicus)

• Dilution:

  WB 1:500 - 1:1000

• Form:

  Liquid

• Buffer:

  Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Molecular Weight:

  Calculated MW: 31kDa/61kDa/63kDa Observed MW: 62kDa

• Storage Conditions:

  Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

• Overview:

  We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SLC47A1 Rabbit pAb (APR21107N9) .

• Gene ID URL:

  https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=55244

• Uniprot URL:

  https://www.uniprot.org/uniprot/Q96FL8

• AA Sequence:

  LNWKKACQQAQVHANLKVNNVPRSGNSALPQDPLHPGCPENLEGILTNDVGKTGEPQSDQQMRQEEPLPEHPQDGAKLSRKQLVLRRGLLL