ATP13A2 Rabbit pAb (APR19679N)

• Background:

  This gene encodes a member of the P5 subfamily of ATPases which transports inorganic cations as well as other substrates. Mutations in this gene are associated with Kufor-Rakeb syndrome (KRS), also referred to as Parkinson disease 9. Multiple transcript variants encoding different isoforms have been found for this gene.

• Synonyms:

  ATP13A2; CLN12; HSA9947; KRPPD; PARK9; SPG78

• Gene ID:

  23400

• UniProt:

  Q9NQ11

• Cellular Locus:

  Lysosome, Membrane, Multi-pass membrane protein

• Applications:

  WB (Homo sapiens)

• Dilution:

  WB 1:500 - 1:2000

• Form:

  Liquid

• Buffer:

  Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Molecular Weight:

  Calculated MW: 125kDa/128kDa Observed MW: 129kDa

• Storage Conditions:

  Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

• Overview:

  We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ATP13A2 Rabbit pAb (APR19679N) .

• Gene ID URL:

  https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=23400

• Uniprot URL:

  https://www.uniprot.org/uniprot/Q9NQ11

• AA Sequence:

  WKPLWGVRLRLRPCNLAHAETLVIEIRDKEDSSWQLFTVQVQTEAIGEGSLEPSPQSQAEDGRSQAAVGAVPEGAWKDTAQLHKSEEAKRVLRYYLFQGQRYIWIETQQAFYQVSLLDHGRSCDDVHRSRHGLSLQDQMVRKAI