PARG Rabbit pAb (APR18192N)

CAT:
882-APR18192N-02
Size:
100 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
PARG Rabbit pAb (APR18192N) - image 1

PARG Rabbit pAb (APR18192N)

  • Background:

    Poly (ADP-ribose) glycohydrolase (PARG) is the major enzyme responsible for the catabolism of poly (ADP-ribose), a reversible covalent-modifier of chromosomal proteins. The protein is found in many tissues and may be subject to proteolysis generating smaller, active products. Several transcript variants encoding different isoforms have been found for this gene.
  • Synonyms:

    PARG; PARG99
  • Gene ID:

    8505
  • UniProt:

    Q86W56
  • Cellular Locus:

    Cytoplasm, Mitochondrion, Mitochondrion matrix, Nucleus
  • Dilution:

    WB 1:1000 - 1:2000
  • Form:

    Liquid
  • Buffer:

    Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
  • Molecular Weight:

    Calculated MW: 54kDa/60kDa/99kDa/102kDa/111kDa Observed MW: 111kDa
  • Storage Conditions:

    Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
  • Overview:

    We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PARG Rabbit pAb (APR18184N7) .
  • Gene ID URL:

    https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=8505
  • Uniprot URL:

    https://www.uniprot.org/uniprot/Q86W56
  • AA Sequence:

    HNECLIITGTEQYSEYTGYAETYRWSRSHEDGSERDDWQRRCTEIVAIDALHFRRYLDQFVPEKMRRELNKAYCGFLRPGVSSENLSAVATGNWGCGAFGGDARLKALIQILAAAAAERDVVYFTFGDSELMRDIYSMHIFLTERKLTVGDVYKLLLRYYNEECRNCSTPGPDIKLYPFIYHAVESCAETADHSGQRTGT