TUBGCP2 Rabbit pAb (APR17907N)

• Background:

  Gamma-tubulin complex is necessary for microtubule nucleation at the centrosome. Plays a role in neuronal migration.

• Synonyms:

  TUBGCP2; GCP-2; GCP2; Grip103; SPBC97; Spc97p; h103p; hGCP2; hSpc97

• Gene ID:

  10844

• UniProt:

  Q9BSJ2

• Cellular Locus:

  Cytoplasm, centrosome, cytoskeleton, microtubule organizing center

• Dilution:

  WB 1:500 - 1:2000

• Form:

  Liquid

• Buffer:

  Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

• Molecular Weight:

  Calculated MW: 88kDa/102kDa/105kDa Observed MW: 102kDa

• Storage Conditions:

  Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

• Overview:

  We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TUBGCP2 Rabbit pAb (APR17907N) .

• Gene ID URL:

  https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10844

• Uniprot URL:

  https://www.uniprot.org/uniprot/Q9BSJ2

• AA Sequence:

  MSEFRIHHDVNELLSLLRVHGGDGAEVYIDLLQKNRTPYVTTTVSAHSAKVKIAEFSRTPEDFLKKYDELKSKNTRNLDPLVYLLSKLTEDKETLQYLQQNAKERAELAAAAVGSSTTSINVPAAASKISMQELEELRKQLGSVATGSTLQQSLELKRKMLRDKQNKKNSGQHLPIFPAW