ESRα Rabbit pAb (APR17406N)

CAT:
882-APR17406N-01
Size:
50 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
ESRα Rabbit pAb (APR17406N) - image 1

ESRα Rabbit pAb (APR17406N)

  • Background:

    This gene encodes an estrogen receptor, a ligand-activated transcription factor composed of several domains important for hormone binding, DNA binding, and activation of transcription. The protein localizes to the nucleus where it may form a homodimer or a heterodimer with estrogen receptor 2. Estrogen and its receptors are essential for sexual development and reproductive function, but also play a role in other tissues such as bone. Estrogen receptors are also involved in pathological processes including breast cancer, endometrial cancer, and osteoporosis. Alternative promoter usage and alternative splicing result in dozens of transcript variants, but the full-length nature of many of these variants has not been determined.
  • Synonyms:

    ESR1; ER; ESR; ESRA; ESTRR; Era; NR3A1; ER alpha
  • Gene ID:

    2099
  • UniProt:

    P03372
  • Cellular Locus:

    Cell membrane, Cytoplasm, Cytoplasmic side, Cytoplasmic side, Golgi apparatus, Nucleus, Peripheral membrane protein, Single-pass type I membrane protein
  • Applications:

    WB (Mus musculus, Homo sapiens)
  • Dilution:

    WB 1:1000 - 1:4000
  • Form:

    Liquid
  • Buffer:

    Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
  • Molecular Weight:

    Calculated MW: 35kDa/47kDa/53kDa/66kDa Observed MW: 66KDa
  • Storage Conditions:

    Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
  • Overview:

    We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ESRα Rabbit pAb (APR17406N) .
  • Gene ID URL:

    https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2099
  • Uniprot URL:

    https://www.uniprot.org/uniprot/P03372
  • AA Sequence:

    MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAKETRYCAVCND