MED18 Antibody: HRP (ARP62134_P050-HRP)

• Gene Name:

  Mediator complex subunit 18

• Gene Aliases:

  SRB5, p28b

• Gene ID:

  54797

• Swiss Prot:

  Q9BUE0

• Accession Number:

  NP_060108

• Host:

  Rabbit

• Reactivity:

  Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

• Immunogen:

  The immunogen is a synthetic peptide directed towards the following sequence KIMVYKIFRILVPGNTDSTEALSLSYLVELSVVAPAGQDMVSDDMKNFAE

• Target:

  MED18 is a component of the Mediator complex, which is a coactivator for DNA-binding factors that activate transcription via RNA polymerase II (Sato et al., 2003 [PubMed 12584197]) .[supplied by OMIM, Oct 2008]

• Partner Proteins:

  HOMEZ; TRIM39; MED20; CAMK2B; UBC; CDK19; CDK8; MED19; MED26; EPAS1; MED11; MED8; MED4; MED16; MED24; MED21; MED14; PIP4K2B; MED1; MED30; MED10; MED28; MED29; MED18; MED15; MED31; MED6; MED13; MED12; MED27; MED17; MED23; TADA2A; MED22; CCNC; MED9; USP49

• Clonality:

  Polyclonal

• Conjugation:

  HRP: Horseradish Peroxidase

• Type:

  Polyclonal Antibody

• Purification:

  Affinity Purified

• Concentration:

  0.5 mg/mL

• Homology:

  Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 86%

• Format:

  Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

• Reconstitution:

  All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

• Molecular Weight:

  24 kDa

• Shipping Conditions:

  Wet Ice

• Protein Length:

  208

• NCBI Gene Symbol:

  MED18

• Protein Name:

  Mediator of RNA polymerase II transcription subunit 18

• Nucleotide Accession Number:

  NM_001127350