MED18 Antibody: HRP (ARP62134_P050-HRP)

CAT:
247-ARP62134_P050-HRP
Size:
100 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
MED18 Antibody: HRP (ARP62134_P050-HRP) - image 1

MED18 Antibody: HRP (ARP62134_P050-HRP)

  • Gene Name:

    Mediator complex subunit 18
  • Gene Aliases:

    SRB5, p28b
  • Gene ID:

    54797
  • Swiss Prot:

    Q9BUE0
  • Accession Number:

    NP_060108
  • Host:

    Rabbit
  • Reactivity:

    Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
  • Immunogen:

    The immunogen is a synthetic peptide directed towards the following sequence KIMVYKIFRILVPGNTDSTEALSLSYLVELSVVAPAGQDMVSDDMKNFAE
  • Target:

    MED18 is a component of the Mediator complex, which is a coactivator for DNA-binding factors that activate transcription via RNA polymerase II (Sato et al., 2003 [PubMed 12584197]) .[supplied by OMIM, Oct 2008]
  • Partner Proteins:

    HOMEZ; TRIM39; MED20; CAMK2B; UBC; CDK19; CDK8; MED19; MED26; EPAS1; MED11; MED8; MED4; MED16; MED24; MED21; MED14; PIP4K2B; MED1; MED30; MED10; MED28; MED29; MED18; MED15; MED31; MED6; MED13; MED12; MED27; MED17; MED23; TADA2A; MED22; CCNC; MED9; USP49
  • Clonality:

    Polyclonal
  • Conjugation:

    HRP: Horseradish Peroxidase
  • Type:

    Polyclonal Antibody
  • Purification:

    Affinity Purified
  • Concentration:

    0.5 mg/mL
  • Homology:

    Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 86%
  • Format:

    Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
  • Reconstitution:

    All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
  • Molecular Weight:

    24 kDa
  • Shipping Conditions:

    Wet Ice
  • Protein Length:

    208
  • NCBI Gene Symbol:

    MED18
  • Protein Name:

    Mediator of RNA polymerase II transcription subunit 18
  • Nucleotide Accession Number:

    NM_001127350