Recombinant Rift valley fever virus Nucleoprotein (N)

CAT:
399-CSB-EP322011REV-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Rift valley fever virus Nucleoprotein (N) - image 1

Recombinant Rift valley fever virus Nucleoprotein (N)

  • Product Name Alternative:

    Nucleocapsid protein Short name:Protein N
  • Abbreviation:

    Recombinant Rift valley fever virus N protein
  • Gene Name:

    N
  • UniProt:

    P21700
  • Expression Region:

    1-245aa
  • Organism:

    Rift valley fever virus (strain ZH-548 M12) (RVFV)
  • Target Sequence:

    MDNYQELRVQFAAQAVDRNEIEQWVREFAYQGFDARRVIELLKQYGGADWEKDAKKMIVLALTRGNKPRRMMMKMSKEGKATVEALINKYKLKEGNPSRDELTLSRVAAALAGWTCQALVVLSEWLPVTGTTMDGLSPAYPRHMMHPSFAGMVDPSLPGDYLRAILDAHSLYLLQFSRVINPNLRGRTKEEVAATFTQPMNAAVNSNFISHEKRREFLKAFGLVDSNGKPSAAVMAAAQAYKTAA
  • Tag:

    N-terminal 6xHis-SUMO-tagged
  • Type:

    In Stock Protein
  • Source:

    E.coli
  • Field of Research:

    Others
  • Endotoxin:

    Not test
  • Purity:

    Greater than 90% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Function:

    Encapsidates the genome, protecting it from nucleases. The encapsidated genomic RNA is termed the nucleocapsid (NC) . Serves as template for viral transcription and replication. After replication, the nucleocapsid is recruited to the host Golgi apparatus by glycoprotein Gn for packaging into virus particles.
  • Molecular Weight:

    43.4 kDa
  • References & Citations:

    "Sequences and coding strategies of the S RNAs of Toscana and Rift Valley fever viruses compared to those of Punta Toro, Sicilian Sandfly fever, and Uukuniemi viruses."Giorgi C., Accardi L., Nicoletti L., Gro M.C., Takehara K., Hilditch C., Morikawa S., Bishop D.H.L.Virology 180:738-753 (1991)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Full Length