Recombinant Human Coactosin-like protein (COTL1)

CAT:
399-CSB-EP622751HU-01
Size:
20 µg

For Laboratory Research Only. Not for Clinical or Personal Use.

  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Human Coactosin-like protein (COTL1) - image 1

Recombinant Human Coactosin-like protein (COTL1)

  • Product Name Alternative:

    CLP; Coactosin like 1; Coactosin-like protein; COTL1; COTL1_HUMAN; FLJ43657; MGC19733
  • Abbreviation:

    Recombinant Human COTL1 protein
  • Gene Name:

    COTL1
  • UniProt:

    Q14019
  • Expression Region:

    2-142aa
  • Organism:

    Homo sapiens (Human)
  • Target Sequence:

    ATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQQCTDDVRLFAFVRFTTGDAMSKRSKFALITWIGENVSGLQRAKTGTDKTLVKEVVQNFAKEFVISDRKELEEDFIKSELKKAGGANYDAQTE
  • Tag:

    N-terminal 6xHis-SUMO-tagged
  • Type:

    Developed Protein
  • Source:

    E.coli
  • Field of Research:

    Signal Transduction
  • Relevance:

    Binds to F-actin in a calcium-independent manner. Has no direct effect on actin depolymerization. Acts as a chaperone for ALOX5 (5LO), influencing both its stability and activity in leukotrienes synthesis.
  • Endotoxin:

    Not test
  • Purity:

    Greater than 90% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Function:

    Binds to F-actin in a calcium-independent manner. Has no direct effect on actin depolymerization. Acts as a chaperone for ALOX5 (5LO), influencing both its stability and activity in leukotrienes synthesis.
  • Molecular Weight:

    31.8 kDa
  • References & Citations:

    Homologous recombination of a flanking repeat gene cluster is a mechanism for a common contiguous gene deletion syndrome.Chen K.-S., Manian P., Koeuth T., Potocki L., Zhao Q., Chinault A.C., Lee C.-C., Lupski J.R.Nat. Genet. 17:154-163 (1997)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Full Length of Mature Protein