WNT7A Antibody

• Catalog number
  R31793
• Price
  Please ask
• Size
  0.1mg

• Category
  Antibody
• Concentration
  0.5mg/ml if reconstituted with 0.2ml sterile DI water
• Form
  Antigen affinity purified
• Conjugation
  Unconjugated
• Clone
  Polyclonal antibody
• Recognised antigen
  WNT7A
• Host animal
  Rabbit (Oryctolagus cuniculus)
• Clonality
  Polyclonal (rabbit origin)
• Species reactivity
  Human (Homo sapiens), Mouse (Mus musculus), Rat ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
• Tested applications
  WB, IHC-P
• Recommended dilutions
  Western blot: 0.1-0.5ug/ml,IHC (Paraffin): 0.5-1ug/ml
• Notes
  Optimal dilution of the WNT7A antibody should be determined by the researcher.
• Intented use
  This WNT7A antibodyis to be used only for research purposes and not for diagnostics..
• Uniprot
  O00755
• Purity
  Antigen affinity
• Description
  This gene is a member of the WNT gene family, which consists of structurally related genes that encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is involved in the development of the anterior-posterior axis in the female reproductive tract, and also plays a critical role in uterine smooth muscle pattering and maintenance of adult uterine function. Mutations in this gene are associated with Fuhrmann and Al-Awadi / Raas – Rothschild / Schinzel phocomelia syndromes.
• Immunogen
  Amino acids YVLKDKYNEAVHVEPVRASRNKRPTFLKIKK of human WNT7A were used as the immunogen for the WNT7A antibody.
• Storage
  After reconstitution, the WNT7A antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
• Properties
  If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  WNT7A  
• Gene symbol
  WNT7A
• Short name
  Anti-WNT7A
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Isotype
  Rabbit IgG
• Alternative name
  Antibodies to WNT7A
• Alternative technique
  antibodies
• Alternative to gene target
  wingless-type MMTV integration site family, member 7A, WNT7A and IDBG-19862 and ENSG00000154764 and 7476, receptor a this GO nist activity, Extracellular, Wnt7a and IDBG-170090 and ENSMUSG00000030093 and 22421, WNT7A and IDBG-646453 and ENSBTAG00000001668 and 533782

Gene info

• Identity
  HGNC:12786
• Gene
  WNT7A
• Long gene name
  Wnt family member 7A
• Synonyms gene name
  • wingless-type MMTV integration site family, member 7A
• Synonyms
  • Wnt-7a
• Synonyms name
  • proto-oncogene Wnt7a protein
• GenBank acession
  • D83175
• Locus
  3p25.1
• Discovery year
  1996-03-12
• Entrez gene record
  7476
• Pubmed identfication
  • 8893824
  • 9161407
• RefSeq identity
  • NM_004625
• Classification
  • Wnt family
• VEGA ID
  OTTHUMG00000129803

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products