Anti-Wnt7a Antibody
-
Catalog numberRP1088
-
PricePlease ask
-
Size100µg/vial
-
-
ClonalityPolyclonal
-
Sample Size Available30ug for $99, contact us for details
-
ImmunogenA synthetic peptide corresponding to a sequence at the C-terminus of human Wnt7a (226-256aa YVLKDKYNEAVHVEPVRASRNKRPTFLKIKK), identical to the related mouse sequence.
-
FormLyophilized
-
PurificationImmunogen affinity purified.
-
Storage Transport ConditionsAt -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing.
-
Cross reactivityNo cross reactivity with other proteins
-
Ig TypeN/A
-
ReconstitutionAdd 0.2ml of distilled water will yield a concentration of 500ug/ml.
-
Application DetailsImmunohistochemistry(Paraffin-embedded Section), 0.5-1µg/ml, Human, Mouse, Rat, By Heat Western blot, 0.1-0.5µg/ml, Human
-
ApplicationsIHC, WB
-
ReactivityHuman, Mouse, Rat
-
Product Datasheetwww.bosterbio.com/datasheet.php?sku=RP1088
-
DescriptionThis antibody needs to be stored at + 4°C in a fridge short term in a concentrated dilution. Freeze thaw will destroy a percentage in every cycle and should be avoided. Antibody for research use.
-
PropertiesIf you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translationanticorps
-
Gene target
-
Gene symbolWNT7A
-
Short nameAnti-Wnt7a Antibody
-
TechniqueAntibody, anti-, anti, antibody to, antibodies, antibodies against human proteins, antibodies for
-
HostRabbit
-
IsotypeN/A
-
Alternative nameAntibody toWnt7a (antibody to-)
-
Alternative techniqueantibodies
-
Alternative to gene targetwingless-type MMTV integration site family, member 7A, WNT7A and IDBG-19862 and ENSG00000154764 and 7476, receptor a this GO nist activity, Extracellular, Wnt7a and IDBG-170090 and ENSMUSG00000030093 and 22421, WNT7A and IDBG-646453 and ENSBTAG00000001668 and 533782
-
Gene info
-
Identity
-
Gene
-
Long gene nameWnt family member 7A
-
Synonyms gene name
- wingless-type MMTV integration site family, member 7A
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1996-03-12
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Wnt family
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data