UNC5C Antibody

• Catalog number
  R31843
• Price
  Please ask
• Size
  0.1mg

• Category
  Antibody
• Concentration
  0.5mg/ml if reconstituted with 0.2ml sterile DI water
• Form
  Antigen affinity purified
• Conjugation
  Unconjugated
• Clone
  Polyclonal antibody
• Recognised antigen
  UNC5C
• Host animal
  Rabbit (Oryctolagus cuniculus)
• Clonality
  Polyclonal (rabbit origin)
• Species reactivity
  Human (Homo sapiens), Mouse (Mus musculus), Rat ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
• Tested applications
  WB
• Recommended dilutions
  Western blot: 0.1-0.5ug/ml
• Notes
  Optimal dilution of the UNC5C antibody should be determined by the researcher.
• Intented use
  This UNC5C antibodyis to be used only for research purposes and not for diagnostics..
• Uniprot
  O95185
• Purity
  Antigen affinity
• Description
  Netrin receptor UNC5C is a protein that in humans is encoded by the UNC5C gene. This gene product belongs to the UNC-5 family of netrin receptors. Netrins are secreted proteins that direct axon extension and cell migration during neural development. They are bifunctional proteins that act as attractants for some cell types and as repellents for others, and these opposite actions are thought to be mediated by two classes of receptors. The UNC-5 family of receptors mediates the repellent response to netrin; they are transmembrane proteins containing 2 immunoglobulin (Ig)-like domains and 2 type I thrombospondin motifs in the extracellular region.
• Immunogen
  Amino acids DLWEAQNFPDGNLSMLAAVLEEMGRHETVVSLAAEGQ of human UNC5C were used as the immunogen for the UNC5C antibody.
• Storage
  After reconstitution, the UNC5C antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
• Properties
  If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  UNC5C  
• Gene symbol
  UNC5C, UNC5C-AS1
• Short name
  Anti-UNC5C
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Isotype
  Rabbit IgG
• Alternative name
  Antibodies to UNC5C
• Alternative technique
  antibodies
• Alternative to gene target
  unc-5 homolog C (C. elegans), UNC5H3, UNC5C and IDBG-30714 and ENSG00000182168 and 8633, protein binding, Plasma membranes, Unc5c and IDBG-196891 and ENSMUSG00000059921 and 22253, UNC5C and IDBG-640984 and ENSBTAG00000002084 and 533256

Gene info

• Identity
  HGNC:12569
• Gene
  UNC5C
• Long gene name
  unc-5 netrin receptor C
• Synonyms gene name
  • unc5 (C.elegans homolog) c
  • unc-5 homolog C (C. elegans)
• GenBank acession
  • AF055634
• Locus
  4q22.3
• Discovery year
  1998-12-09
• Entrez gene record
  8633
• Pubmed identfication
  • 9126742
  • 9782087
  • 12655055
• RefSeq identity
  • NM_003728
• Classification
  • I-set domain containing
• VEGA ID
  OTTHUMG00000130989

Gene info

• Identity
  HGNC:55246
• Gene
  UNC5C-AS1
• Long gene name
  UNC5C antisense RNA 1
• Locus
  4q22.3
• Discovery year
  2020-09-17
• Entrez gene record
  105377335
• Classification
  • Antisense RNAs

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products