SOX5 Antibody

• Catalog number
  R32081
• Price
  Please ask
• Size
  0.1mg

• Category
  Antibody
• Concentration
  0.5mg/ml if reconstituted with 0.2ml sterile DI water
• Form
  Antigen affinity purified
• Conjugation
  Unconjugated
• Clone
  Polyclonal antibody
• Recognised antigen
  SOX5
• Host animal
  Rabbit (Oryctolagus cuniculus)
• Clonality
  Polyclonal (rabbit origin)
• Species reactivity
  Human (Homo sapiens), Rat ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
• Tested applications
  WB
• Recommended dilutions
  Western blot: 0.1-0.5ug/ml
• Notes
  Optimal dilution of the SOX5 antibody should be determined by the researcher.
• Intented use
  This SOX5 antibodyis to be used only for research purposes and not for diagnostics..
• Uniprot
  P35711
• Purity
  Antigen affinity
• Description
  Transcription factor SOX-5 is a protein that in humans is encoded by the SOX5 gene. It is located on 12p12.1. This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. In addition, the encoded protein may play a role in chondrogenesis. A pseudogene of this gene is located on chromosome 8. Multiple transcript variants encoding distinct isoforms have been identified for this gene.
• Immunogen
  Amino acids EKEKTTLESLTQQLAVKQNEEGKFSHAMMDFNLS of human SOX5 were used as the immunogen for the SOX5 antibody.
• Storage
  After reconstitution, the SOX5 antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
• Properties
  If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  SOX5  
• Gene symbol
  SOX5, SOX5-AS1
• Short name
  Anti-SOX5
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Isotype
  Rabbit IgG
• Alternative name
  Antibodies to SOX5
• Alternative technique
  antibodies

Gene info

• Identity
  HGNC:11201
• Gene
  SOX5
• Long gene name
  SRY-box transcription factor 5
• Synonyms gene name
  • SRY (sex determining region Y)-box 5
  • SRY-box 5
• Synonyms
  • L-SOX5
  • MGC35153
• GenBank acession
  • AB081589
• Locus
  12p12.1
• Discovery year
  1997-07-07
• Entrez gene record
  6660
• Pubmed identfication
  • 8812465
• RefSeq identity
  • NM_006940
• Classification
  • SRY-box transcription factors
• VEGA ID
  OTTHUMG00000169026

Gene info

• Identity
  HGNC:53311
• Gene
  SOX5-AS1
• Long gene name
  SOX5 antisense RNA 1
• Locus
  12p12.1
• Discovery year
  2017-03-22
• Entrez gene record
  101928471
• RefSeq identity
  • NR_120472
• Classification
  • Antisense RNAs

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products