SLC5A8 Blocking Peptide

• Catalog number
  33R-3337
• Price
  Please ask
• Size
  100 ug

• Product Type
  Proteins
• Product Subtype
  Blocking Peptides
• Research Area
  Cell Biology
• Tag Conjugate
  GILVPFANSIGALVGLMAGFAISLWVGIGAQIYPPLPERTLPLHLDIQGC
• Type1
  Synthetic
• Form Buffer
  Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
• Storage
  Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
• Applications
  WB, IHC
• Shipping Info
  Blue Ice
• Test
  You can block the antibody by the specific target amino acid sequence of peptide.
• Properties
  blocking peptide
• Description
  Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.

• Gene target
  SLC5A8  
• Gene symbol
  SLC5A8
• Short name
  SLC5A8 Blocking Peptide
• Technique
  blocking peptide, Blocking, peptide, blocking peptides, fitzgerald made this blocking amino acid sequence or peptide to block the gene target in a volume of 1. For western blot it is often requested to block your antibody and to see the band of the analyzed protein disappear. This is called a negative control by blocking the WB antibody. peptides
• Alternative name
  solute carrier family 5 (iodide transporter), member 8 inhibiting short protein sequence
• Alternative technique
  control, peptides
• Alternative to gene target
  solute carrier family 5 (iodide transporter), member 8, SLC5A8 and IDBG-547244 and ENSG00000256870 and 160728, symporter activity, Plasma membranes, Slc5a8 and IDBG-183999 and ENSMUSG00000020062 and 216225, SMCT1 and IDBG-636931 and ENSBTAG00000011525 and 615734

Gene info

• Identity
  HGNC:19119
• Gene
  SLC5A8
• Long gene name
  solute carrier family 5 member 8
• Synonyms gene name
  • solute carrier family 5 (iodide transporter), member 8
  • solute carrier family 5 (sodium/monocarboxylate cotransporter), member 8
• Synonyms
  • AIT
• GenBank acession
  • AY081220
• Locus
  12q23.1-q23.2
• Discovery year
  2003-05-12
• Entrez gene record
  160728
• Pubmed identfication
  • 12107270
  • 12829793
• RefSeq identity
  • NM_145913
• Classification
  • Solute carriers
• VEGA ID
  OTTHUMG00000170499

Similar products