SERPINE1 Blocking Peptide

• Catalog number
  33R-9417
• Price
  Please ask
• Size
  100 µg

• Category
  Proteins
• Antibody Subtype
  Blocking Peptides
• Area of research
  Proteases, Inhibitors, & Enzymes
• Residues
  VAHLASDFGVRVFQQVAQASKDRNVVFSPYGVASVLAMLQLTTGGETQQQ
• Type of protein
  Synthetic
• Form Buffer
  Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
• Storage
  Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB; IHC
• URL
• More info
• Test
  You can block the antibody by the specific target amino acid sequence of peptide.
• Properties
  blocking peptide
• Description
  Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.

• Gene target
  SERPINE1  
• Gene symbol
  SERPINE1
• Short name
  SERPINE1 Blocking Peptide
• Technique
  blocking peptide, Blocking, peptide, blocking peptides, fitzgerald made this blocking amino acid sequence or peptide to block the gene target in a volume of 1. For western blot it is often requested to block your antibody and to see the band of the analyzed protein disappear. This is called a negative control by blocking the WB antibody. peptides
• Alternative name
  A synthetic peptide for use as a blocking control in assays to test for specificity of SERPINE1 antibody, catalog no. 70R-5413
• Alternative technique
  control, peptides
• Alternative to gene target
  serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 1, PAI and PAI-1 and PAI1 and PLANH1, SERPINE1 and IDBG-32959 and ENSG00000106366 and 5054, protein binding, Extracellular, Serpine1 and IDBG-204786 and ENSMUSG00000037411 and 18787, SERPINE1 and IDBG-640415 and ENSBTAG00000014465 and 281375

Gene info

• Identity
  HGNC:8583
• Gene
  SERPINE1
• Long gene name
  serpin family E member 1
• Synonyms gene
  • PLANH1
  • PAI1
• Synonyms gene name
  • serine (or cysteine) proteinase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 1
• Synonyms
  • PAI
• Synonyms name
  • plasminogen activator inhibitor, type I
• GenBank acession
  • M16006
• Locus
  7q22.1
• Discovery year
  1986-01-01
• Entrez gene record
  5054
• Pubmed identfication
  • 3097076
  • 2891140
  • 24172014
• RefSeq identity
  • NM_000602
• Classification
  • Serpin peptidase inhibitors
• VEGA ID
  OTTHUMG00000157107
• Locus Specific Databases
  • LRG_597

Similar products