SAPK4 Antibody

• Catalog number
  PB9721
• Price
  Please ask
• Size
  0,1 mg

• Target antigen
  SAPK4
• Clonality
  Polyclonal antibody
• Clone
  Polyclonal antibody
• Raised in
  rabbit
• Type of the antibody
  IgG polyclonal antibody
• Product form
  freeze-dried
• Reacts with species
  mouse, rat
• Analyses
  WB,IHC-P
• Immunogen
  A synthetic peptide corresponding to a sequence at the C-terminus of human SAPK4 (332-365aa KLTVDEWKQHIYKEIVNFSPIARKDSRRRSGMKL), different from the related mouse sequence by two amino acids, and from the related rat sequence by three amino acids.
• Product configuration
  Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Purification
  Immunogen affinity purified.
• Solubilization
  The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
• Storage condtions
  Keep the SAPK4 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
• Tips
  The SAPK4 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
• Background
  MAPK13 (Mitogen-Activated Protein Kinase 13), also called p38-DELTA or Stress-Activated Protein Kinase 4(SAPK4), is an enzyme that in humans is encoded by the MAPK13 gene. The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is closely related to p38 MAP kinase, both of which can be activated by proinflammatory cytokines and cellular stress. MAP kinase kinases 3, and 6 can phosphorylate and activate this kinase. Transcription factor ATF2, and microtubule dynamics regulator stathmin have been shown to be the substrates of this kinase.
• Related articles
  1. Goedert, M., Cuenda, A., Craxton, M., Jakes, R., Cohen, P. Activation of the novel stress-activated protein kinase SAPK4 by cytokines and cellular stresses is mediated by SKK3 (MKK6); comparison of its substrate specificity with that of other SAP kinases. EMBO J. 16: 3563-3571, 1997. 2. Kumar, S., McDonnell, P. C., Gum, R. J., Hand, A. T., Lee, J. C., Young, P. R. Novel homologues of CSBP/p38 MAP kinase: activation, substrate specificity and sensitivity to inhibition by pyridinyl imidazoles. Biochem. Biophys. Res. Commun. 235: 533-538, 1997. 3. Wang, X. S., Diener, K., Manthey, C. L., Wang, S., Rosenzweig, B., Bray, J., Delaney, J., Cole, C. N., Chan-Hui, P.-Y., Mantlo, N., Lichenstein, H. S., Zukowski, M., Yao, Z. Molecular cloning and characterization of a novel p38 mitogen-activated protein kinase. J. Biol. Chem. 272: 23668-23674, 1997.
• Gene Name
  MAPK13
• Protein Name
  Mitogen-activated protein kinase 13
• Gene Full Name
  mitogen-activated protein kinase 13
• Synonyms
  MAP kinase 13 antibody|MAP kinase p38 delta antibody|MAPK 13 antibody|MAPK-13 antibody| Mapk13 antibody|MGC99536 antibody|Mitogen activated protein kinase 13 antibody|Mitogen-activated protein kinase 13 antibody|Mitogen-activated protein kinase p38 delta antibody| MK13_HUMAN antibody|OTTHUMP00000016282 antibody|OTTHUMP00000016283 antibody|p38 delta antibody|P38delta antibody|PRKM13 antibody|SAPK 4 antibody|SAPK4 antibody|Stress activated protein kinase 4 antibody|Stress-activated protein kinase 4 antibody
• Uniprot ID
  O15264
• Entrez GeneID
  5603
• Properties
  If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  SAPK4  
• Gene symbol
  MAPK13
• Short name
  SAPK4 Antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  SAPK4 (antibody to-)
• Alternative technique
  antibodies

Gene info

• Identity
  HGNC:6875
• Gene
  MAPK13
• Long gene name
  mitogen-activated protein kinase 13
• Synonyms gene
  • PRKM13
• Synonyms
  • SAPK4
  • p38delta
• GenBank acession
  • Y10488
• Locus
  6p21.31
• Discovery year
  1998-04-28
• Entrez gene record
  5603
• Pubmed identfication
  • 9295308
  • 9218798
• Classification
  • Mitogen-activated protein kinases
• VEGA ID
  OTTHUMG00000014587

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products