Rekombinant Human Urokinase (PLAU) (Recombinant Protein)

  • Catalog number
    33 100 103
  • Price
    Please ask
  • Size
    100 µg
  • Protein type
    Recombinant
  • Protein subtype
    EC 3.4.21.73
  • Protein family
    Kinase
  • Protein description
    PLAU specifically cleaves the zymogen plasminogen to form the active enzyme plasmin.
  • Research area interests
    Diseases associated with PLAU include Quebec Platelet Disorder and Alzheimer Disease. Among its related pathways are Wnt Signaling Pathway (WikiPathways) and Integrin Pathway.
  • Package form
    liquid
  • Tested applications
    Screening of inhibitors for Urokinase; Characterization of structure and function;
  • Other names
    PLAU, Plasminogen Activator, Urokinase; U-Plasminogen Activator
  • Peptide sequence
    MRALLARLLLCVLVVSDSKGSNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKPLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL
  • Available target modification
    No
  • Expression system
    E.coli
  • Product Subtype
    protein fragment
  • Active form
    Yes
  • Tag
    untagged
  • Contents
    50 mM Tris-HCl pH 7.0, 100 mM NaCl, 0.05% NaN3
  • Protein purity
    >95%
  • Molecular weight
    47 kDa
  • UniProt number
    P00749
  • Gene number
    5328
  • Abbreviation
    PLAU
  • Full name
    plasminogen activator, urokinase
  • Other desciption
    Rekombinant human Urokinase expressed in E.coli without the signal peptide, Gene name: PLAU; Gene Alias: ATF,UPA, URK, u-PA, GenBank Accession # BC013575, Swiss Prot P00749. It appears as a major protein of about 47 kDa and represents more than 95 % of total protein.
  • Purification
    Mentioned in the data sheet
  • PubMed citations
    See the data sheet
  • Warnings
    For Research Use only.
  • Shipping conditions
    dry ice
  • Storage condition
    Store at -70°C
  • Technical datasheet
    Contact us to receive the datasheet
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    PLAU
  • Short name
    Rekombinant Urokinase (PLAU) (Recombinant Protein)
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. biotez advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Species
    Homo sapiens, Humans
  • Alternative name
    Rekombinant H. sapiens Urokinase (plasminogen activator, urokinase) (Rec. Protein)
  • Alternative technique
    rec
  • Alternative to gene target
    plasminogen activator, urokinase, ATF and BDPLT5 and QPD and u-PA and UPA and URK, PLAU and IDBG-78889 and ENSG00000122861 and 5328, protein binding, Extracellular, Plau and IDBG-136606 and ENSMUSG00000021822 and 18792, PLAU and IDBG-630603 and ENSBTAG00000005947 and 281408
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee