Recombinant Chlamydia trachomatis Small cysteine-rich outer membrane protein OmcA(OmcA)

• Catalog number
  RPC20395
• Price
  Please ask
• Size
  500 μg

• Verified reactivity
  Chlamydia trachomatis
• Protein number
  P0CC05
• Gene number
  omcA
• Other name
  9 kDa cysteine-rich lipoprotein; Short name:9kDa-CRP
• Protein origin
  E.coli
• Protein region
  19-88aa
• Protein sequence
  CCRIVDCCFEDPCAPIQCSPCESKKKDVDGGCNSCNGYVPACKPCGGDTHQDAKHGPQARGIPVDGKCRQ
• Information about sequence
  Full Length
• Expected molecular weight
  23.7kDa
• Protein purity
  ≥ 90%
• Storage recommendation
  Aliquot and store at -20°C. Minimize freezing and thawing.
• Use before
  1 year
• Shipping requirements
  Blue ice
• Estimated production time
  7-11 business days
• Notes
  For research use only. Not for diagnostic procedures.
• Hyperlink
• Gene
  Cys or cysteines ChEMBL54943
• Description
  Associated membrane protein types are lipopolysaccharide selective barriers. Biological membranes include cell membranes, outer coverings of cells or organelles that allow passage of certain proteins and nuclear membranes, which cover a cell nucleus; and tissue membranes, such as mucosae and serosae. 
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Chlamydia   trachomatis   cysteine-rich   outer   membrane   protein   OmcA   OmcA  
• Short name
  Recombinant Chlamydia trachomatis cysteine-rich outer protein OmcA(OmcA)
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Label
  N-terminal 6xHis-SUMO-tagged
• Species
  Chlamydia, Chlamydias
• Alternative name
  Rec. Chlamydia trachomatis Small cysteine-rich outer membrane protein OmcA(OmcA)
• Alternative technique
  rec
• Disease
  chlamydia, Cervix, urethra an eye infection by Chlamydia trachomatis can form inclusion bodies in humans.

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products