Recombinant Schistosoma Japonicum Glutathione S-transferase Class-mu 26 kDa Isozyme/GST

• Catalog number
  CG20-50
• Price
  Please ask
• Size
  50 ug

• Description
  Recombinant Schistosoma Japonicum Glutathione S-transferase Class-mu 26 kDa Isozyme is produced by our E.coli expression system and the target gene encoding Met1-Lys218 is expressed.
• Species reactivity
  Schistosoma Japonicum
• Origin
  Escherichia coli
• Peptide sequence
  MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSD
• Estimated molecular weight
  25,7 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Ambient/Room Temperature
• Package form
  Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4.
• Storage conditions
  Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
• Reconstitution conditions
  See included datasheet or contact us for more information.
• UniProt number
  P08515
• Other related products
• Additional description
  The kilo Daltons subunit weight of Recombinant Schistosoma Japonicum Glutathione S-transferase Class-mu 26 Isozyme/GST compared to your protein ladder can be shifted a little due to electrophoresis effects. 1 kDa = 1000 g/mol protein
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Schistosoma   Japonicum   Glutathione   S-transferase   Class-mu   Isozyme/GST  
• Gene symbol
  MGST3
• Short name
  Recombinant Schistosoma Japonicum Glutathione S-transferase Class-mu 26 Isozyme/GST
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Alternative name
  Recombinant Schistosoma Japonicum GST
• Alternative technique
  rec

Gene info

• Identity
  HGNC:7064
• Gene
  MGST3
• Long gene name
  microsomal glutathione S-transferase 3
• Synonyms
  • GST-III
• Synonyms name
  • microsomal glutathione S-transferase III
  • microsomal GST-3
  • microsomal GST-III
• GenBank acession
  • AF026977
• Locus
  1q24.1
• Discovery year
  1997-10-16
• Entrez gene record
  4259
• Pubmed identfication
  • 9278457
• RefSeq identity
  • NM_004528
• Classification
  • Microsomal glutathione S-transferases
• VEGA ID
  OTTHUMG00000034627

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products