Recombinant Rat Fibroblast growth factor 23 Fgf23

Recombinant Rat Fibroblast growth factor 23 Fgf23 is available 5 times from Bioma labs

RPC20040 | Recombinant Rat Fibroblast growth factor 23(Fgf23)size: 50 μg | 368.06 USD

Ajax processing

RPC20040 | Recombinant Rat Fibroblast growth factor 23(Fgf23)size: 200 μg | 818.43 USD

Ajax processing

RPC20040 | Recombinant Rat Fibroblast growth factor 23(Fgf23)size: 100 μg | 544.44 USD

Ajax processing

RPC20040 | Recombinant Rat Fibroblast growth factor 23(Fgf23)size: 1 mg | 1880.26 USD

Ajax processing

RPC20040 | Recombinant Rat Fibroblast growth factor 23(Fgf23)size: 10 μg | 194.02 USD

Ajax processing
  • Verified reactivity
    Rattus norvegicus (Rat)
  • Protein number
    Q8VI82
  • Gene number
    Fgf23
  • Other name
    no alternative name
  • Protein origin
    E.coli
  • Protein region
    25-251aa
  • Protein sequence
    YSDTSPLLGSNWGSLTHLYTATARNSYHLQIHRDGHVDGTPHQTIYSALMITSEDAGSVVIIGAMTRRFLCMDLRGNIFGSYHFSPENCRFRQWTLENGYDVYLSPKHHYLVSLGRSKRIFQPGTNPPPFSQFLARRNEVPLLHFYTARPRRHTRSAEDPPERDPLNVLKPRPRATPIPVSCSRELPSAEEGGPAASDPLGVLRRGRGDARRGAGGTDRCRPFPRFV
  • Information about sequence
    Full Length
  • Protein purity
    ≥ 90%
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Use before
    1 year
  • Shipping requirements
    Blue ice
  • Estimated production time
    7-11 business days
  • Notes
    For research use only. Not for diagnostic procedures.
  • Gene name
    Fgf23
  • Description
    Aplha, transcription related growth factors and stimulating factors or repressing nuclear factors are complex subunits of proteins involved in cell differentiation. Complex subunit associated factors are involved in hybridoma growth, Eosinohils, eritroid proliferation and derived from promotor binding stimulating subunits on the DNA binding complex. NFKB 105 subunit for example is a polypetide gene enhancer of genes in B cells.
  • About
    Rats are used to make rat monoclonal anti mouse antibodies. There are less rat- than mouse clones however. Rats genes from rodents of the genus Rattus norvegicus are often studied in vivo as a model of human genes in Sprague-Dawley or Wistar rats.
  • Latin name
    Rattus norvegicus
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Short name
    Recombinant Fibroblast growth factor 23(Fgf23)
  • Technique
    Recombinant
  • Host
    Rat
  • Species
    Rat
  • Alternative name
    recombinant Rat Fibroblast growth factor 23(Fgf23)
  • Alternative technique
    rec
Simillar products
Supplier:abbex
Price:397.45USD
Supplier:aviva
Price:498.58USD
Supplier:MBS Recombinant
Price:2 014.32USD
Supplier:MyBioSource
Price:0.00USD
Supplier:ABM microrna
Price:419.80USD
Supplier:trca
Price:357.47USD
Supplier:Cusabio
Price:249.29USD
Supplier:ABM CrispR
Price:6 844.91USD
Supplier:Cloud Clone Corp
Price:801.96USD
Supplier:abbex
Price:337.48USD
Supplier:MyBioSource
Price:0.00USD
Supplier:MyBioSource
Price:0.00USD
Supplier:MBS Recombinant
Price:2 196.58USD
Supplier:MBS Recombinant
Price:2 073.11USD
Supplier:Biovision
Price:317.49USD
Supplier:MBS Polyclonals
Price:766.69USD
Filters
+32-(0)1-658-90-45 lieven@gentaur.com
Recombinant Rat Fibroblast growth factor 23 Fgf23
Contact
Chat with gentaur.com employee