Recombinant Naja kaouthia Cobra venom factor,partial

• Catalog number
  RPC20298
• Price
  Please ask
• Size
  1 mg

• Verified reactivity
  Naja kaouthia (Monocled cobra) (Naja siamensis)
• Protein number
  Q91132
• Gene number
  Please refer to GenBank
• Other name
  Complement C3 homolog
• Protein origin
  E.coli
• Protein region
  733-984aa
• Protein sequence
  DDNEDGFIADSDIISRSDFPKSWLWLTKDLTEEPNSQGISSKTMSFYLRDSITTWVVLAVSFTPTKGICVAEPYEIRVMKVFFIDLQMPYSVVKNEQVEIRAILHNYVNEDIYVRVELLYNPAFCSASTKGQRYRQQFPIKALSSRAVPFVIVPLEQGLHDVEIKASVQEALWSDGVRKKLKVVPEGVQKSIVTIVKLDPRAKGVGGTQLEVIKARKLDDRVPDTEIETKIIIQGDPVAQIIENSIDGSKLN
• Information about sequence
  Partial
• Expected molecular weight
  44.37kDa
• Protein purity
  ≥ 90%
• Storage recommendation
  Aliquot and store at -20°C. Minimize freezing and thawing.
• Use before
  1 year
• Shipping requirements
  Blue ice
• Estimated production time
  7-11 business days
• Notes
  For research use only. Not for diagnostic procedures.
• Hyperlink
• Description
  Aplha, transcription related growth factors and stimulating factors or repressing nuclear factors are complex subunits of proteins involved in cell differentiation. Complex subunit associated factors are involved in hybridoma growth, Eosinohils, eritroid proliferation and derived from promotor binding stimulating subunits on the DNA binding complex. NFKB 105 subunit for example is a polypetide gene enhancer of genes in B cells.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Naja   kaouthia   Cobra   venom   factor   partial  
• Short name
  Recombinant Naja kaouthia Cobra venom factor partial
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Label
  N-terminal 6xHis-SUMO-tagged
• Alternative name
  Rec. Naja kaouthia Cobra venom factor,partial
• Alternative technique
  rec

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products