Recombinant Mpuse Interleukin-2 receptor subunit beta(Il2rb),partial

  • Catalog number
    RPC20231
  • Price
    Please ask
  • Size
    50 μg
  • Verified reactivity
    Mus musculus (Mouse)
  • Protein number
    P16297
  • Gene number
    Il2rb
  • Other name
    High affinity IL-2 receptor subunit betap70-75; CD122
  • Protein origin
    Yeast
  • Protein region
    27-240aa
  • Protein sequence
    AVKNCSHLECFYNSRANVSCMWSHEEALNVTTCHVHAKSNLRHWNKTCELTLVRQASWACNLILGSFPESQSLTSVDLLDINVVCWEEKGWRRVKTCDFHPFDNLRLVAPHSLQVLHIDTQRCNISWKVSQVSHYIEPYLEFEARRRLLGHSWEDASVLSLKQRQQWLFLEMLIPSTSYEVQVRVKAQRNNTGTWSPWSQPLTFRTRPADPMKE
  • Information about sequence
    Extracellular Domain
  • Expected molecular weight
    25.75kDa
  • Protein purity
    ≥ 90%
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Use before
    1 year
  • Shipping requirements
    Blue ice
  • Estimated production time
    7-11 business days
  • Notes
    For research use only. Not for diagnostic procedures.
  • Description
    The receptors are ligand binding factors of type 1, 2 or 3 and protein-molecules that receive chemical-signals from outside a cell. When such chemical-signals couple or bind to a receptor, they cause some form of cellular/tissue-response, e.g. a change in the electrical-activity of a cell. In this sense, am olfactory receptor is a protein-molecule that recognizes and responds to endogenous-chemical signals, chemokinesor cytokines e.g. an acetylcholine-receptor recognizes and responds to its endogenous-ligand, acetylcholine. However, sometimes in pharmacology, the term is also used to include other proteins that are drug-targets, such as enzymes, transporters and ion-channels.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Short name
    Recombinant Mpuse Interleukin-2 receptor subunit beta(Il2rb),partial
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Label
    N-terminal 6xHis-tagged
  • Alternative name
    Rec. Mpuse Interleukin-2 receptor functionnal sequence b(interleukin 2 receptor, b),partial
  • Alternative technique
    rec
  • Alternative to gene target
    interleukin 2 receptor, beta, CD122 and IL15RB and P70-75, IL2RB and IDBG-6418 and ENSG00000100385 and 3560, interleukin-2 binding, Cell surfaces, Il2rb and IDBG-159374 and ENSMUSG00000068227 and 16185, IL2RB and IDBG-638176 and ENSBTAG00000016345 and 510185
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee