Recombinant Mouse Tumor Necrosis Factor Receptor I/TNFRSF1A/CD120a

  • Catalog number
    CG50-1000
  • Price
    Please ask
  • Size
    1 mg
  • Description
    Recombinant Mouse Tumor Necrosis Factor Receptor I is produced by our E.coli expression system and the target gene encoding Ile22-Ala212 is expressed.
  • Species reactivity
    Mouse
  • Origin
    Escherichia coli
  • Peptide sequence
    MIHPSGVTGLVPSLGDREKRDSLCPQGKYVHSKNNSICCTKCHKGTYLVSDCPSPGRDTVCRECEKGTFTASQNYLRQCLSCKTCRKEMSQVEISPCQADKDTVCGCKENQFQRYLSETHFQCVDCSPCFNGTVTIPCKETQNTVCNCHAGFFLRESECVPCSHCKKNEECMKLCLPPPLANVTNPQDSGTA
  • Estimated molecular weight
    21,2 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Ambient/Room Temperature
  • Package form
    Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4.
  • Storage conditions
    Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at below -20°C for 3 months.
  • Reconstitution conditions
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
  • UniProt number
    P25118
  • Additional description
    Aplha, transcription related growth factors and stimulating factors or repressing nuclear factors are complex subunits of proteins involved in cell differentiation. Complex subunit associated factors are involved in hybridoma growth, Eosinohils, eritroid proliferation and derived from promotor binding stimulating subunits on the DNA binding complex. NFKB 105 subunit for example is a polypetide gene enhancer of genes in B cells. The receptors are ligand binding factors of type 1, 2 or 3 and protein-molecules that receive chemical-signals from outside a cell. When such chemical-signals couple or bind to a receptor, they cause some form of cellular/tissue-response, e.g. a change in the electrical-activity of a cell. In this sense, am olfactory receptor is a protein-molecule that recognizes and responds to endogenous-chemical signals, chemokinesor cytokines e.g. an acetylcholine-receptor recognizes and responds to its endogenous-ligand, acetylcholine. However, sometimes in pharmacology, the term is also used to include other proteins that are drug-targets, such as enzymes, transporters and ion-channels.
  • Test
    Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
  • Latin name
    Mus musculus
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    TNFRSF1A
  • Short name
    Recombinant Mouse Tumor Necrosis Factor Receptor I/TNFRSF1A/CD120a
  • Technique
    Recombinant, Mouse, mouses, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Host
    mouse
  • Species
    Mouse, Mouses
  • Alternative name
    Mouse TNF R1/TNFRSF1A/CD120a
  • Alternative technique
    rec, murine
  • Alternative to gene target
    tumor necrosis factor receptor superfamily, member 1A, CD120a and FPF and MS5 and p55 and p55-R and p60 and TBP1 and TNF-R and TNF-R-I and TNF-R55 and TNFAR and TNFR1 and TNFR1-d2 and TNFR55 and TNFR60, TNFRSF1A and IDBG-13807 and ENSG00000067182 and 7132, tumor necrosis factor binding, nuclei, Tnfrsf1a and IDBG-189844 and ENSMUSG00000030341 and 21937, TNFRSF1A and IDBG-640513 and ENSBTAG00000004211 and 282527
  • Tissue
    tumor
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: A cytologic technique for measuring the functional capacity of tumor stem cells by assaying their activity. It is used primarily for the in vitro testing of antineoplastic agents.
  • Tree numbers
    • E01.370.225.500.383.910
    • E01.370.225.500.388.930
    • E05.200.500.383.910
    • E05.200.500.388.930
    • E05.242.383.910
    • E05.242.417.500
    • E05.337.550.200.800
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee