Recombinant Mouse TNF alpha

  • Catalog number
    RP0374M-005
  • Price
    Please ask
  • Size
    5 ug
  • Product Type
    Protein
  • Target
    TNF alpha
  • Alias
    TNFSF2
  • MW
    17.3 kDa
  • Form
    Lyophilized
  • Storage
    -20 °C
  • Shipping
    Ambient
  • Entrez Gene ID
    21926
  • Protein Sequence
    LRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL (156)
  • Source
    Yeast
  • Description
    The Recombinant Mouse TNF alpha is a α- or alpha protein sometimes glycoprotein present in blood.
  • Test
    Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
  • Latin name
    Mus musculus
  • Additional source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene
    Tumor necrosis factor (TNFa, tumor necrosis factor alpha, TNFα, cachexin, or cachectin) is a cell signaling protein (cytokine) involved in systemic inflammation and is one of the cytokines that make up the acute phase reaction. It is produced chiefly by activated macrophages, although it can be produced by many other cell types such as CD4+ lymphocytes, NK cells, neutrophils, mast cells, eosinophils, and neurons. TNFb or TNF beta also bin on TNF receptors for Th1 activation.
  • Gene target
    TNF   alpha  
  • Gene symbol
    TNF, TNFRSF1A, TNFRSF1B, LTBR
  • Short name
    Recombinant Mouse TNF alpha
  • Technique
    Recombinant, Mouse, mouses, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. kingfisherbiotech advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Host
    mouse
  • Species
    Mouse, Mouses
  • Alternative name
    Rec. Mouse tumor necrosis factor a
  • Alternative technique
    rec, murine
  • Alternative to gene target
    tumor necrosis factor, DIF and TNF-alpha and TNFA and TNFSF2, TNF and IDBG-300259 and ENSG00000232810 and 7124, transcription regulatory region DNA binding, Extracellular, Tnf and IDBG-177358 and ENSMUSG00000024401 and 21926, TNF and IDBG-634161 and ENSBTAG00000025471 and 280943
Gene info
Gene info
Gene info
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee