Recombinant Mouse Tissue Inhibitor of Metalloproteinases 2/TIMP-2 (C-6His)

  • Catalog number
    CC68-50
  • Price
    Please ask
  • Size
    50 ug
  • Description
    Recombinant Mouse Tissue Inhibitor of Metalloproteinases 2 is produced by our expression system and the target gene encoding Cys27-Pro220 is expressed
  • Species reactivity
    Mouse
  • Origin
    Human cells
  • Peptide sequence
    CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPDKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSITQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKSINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDPHHHHHH
  • Estimated molecular weight
    22,5 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Dry ice/ice packs
  • Package form
    Supplied as a 0.2 µm filtered solution of 20mM TrisHCl,150mM NaCl,pH7.5.
  • Storage conditions
    Store at below -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
  • Reconstitution conditions
    See included datasheet or contact us for more information.
  • UniProt number
    P25785
  • Additional description
    Tissue, pathway, proteinase, peptidase, protease ,acrosin, lipoprotein, activator, caspase, trypsin, papain, esterase inhibitors are proteins or receptor ligands or receptor antagonists that bind to an enzyme receptor and decreases its activity. Since blocking an enzyme's activity can kill a pathogen or correct a metabolic imbalance, many drugs are enzyme inhibitors. Not all receptor antagonist that bind to enzymes are inhibitors; enzyme activator ligands or agonists bind to enzymes and increase their enzymatic activity, while enzyme substrates bind and are converted to products in the normal catalytic cycle of the enzyme. 6
  • Test
    Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
  • Latin name
    Mus musculus
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    TIMP2, TIMP1, MIR1289-2, MIR521-2, MIR509-2, MIR512-2, MIR7-2, MIR329-2, RNU6-2, KRTAP13-2
  • Short name
    Recombinant Mouse Tissue Inhibitor of Metalloproteinases 2/TIMP-2 (C-6His)
  • Technique
    Recombinant, tissue, Mouse, mouses, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture. tissues
  • Host
    mouse
  • Species
    Mouse, Mouses
  • Alternative name
    Recombinant Mouse TIMP-2 (C-6His)
  • Alternative technique
    rec, tissues, murine
  • Tissue
    tissue
Gene info
  • Identity
  • Gene
  • Long gene name
    TIMP metallopeptidase inhibitor 2
  • Synonyms gene name
    • tissue inhibitor of metalloproteinase 2
  • Synonyms
  • Locus
  • Discovery year
    1992-06-18
  • Entrez gene record
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • Tissue inhibitor of metallopeptidases
  • VEGA ID
Gene info
  • Identity
  • Gene
  • Long gene name
    TIMP metallopeptidase inhibitor 1
  • Synonyms gene
  • Synonyms gene name
    • tissue inhibitor of metalloproteinase 1 (erythroid potentiating activity, collagenase inhibitor)
  • Synonyms
  • Locus
  • Discovery year
    1986-01-01
  • Entrez gene record
  • RefSeq identity
  • Classification
    • Tissue inhibitor of metallopeptidases
  • VEGA ID
  • Locus Specific Databases
Gene info
Gene info
Gene info
Gene info
Gene info
Gene info
Gene info
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee