Recombinant Mouse Peptidyl-prolyl Cis-trans Isomerase A/Cyclophilin A/CYPA

• Catalog number
  CR16-500
• Price
  Please ask
• Size
  500 ug

• Description
  Recombinant Mouse Peptidyl-prolyl Cis-trans Isomerase A is produced by our E.coli expression system and the target gene encoding Met1-Leu164 is expressed.
• Species reactivity
  Mouse
• Origin
  Escherichia coli
• Peptide sequence
  MVNPTVFFDITADDEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSSFHRIIPGFMCQGGDFTRHNGTGGRSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITISDCGQL
• Estimated molecular weight
  18 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Dry Ice/ice packs
• Package form
  Supplied as a 0.2 µm filtered solution of PBS, 10%glycerol, pH7.4.
• Storage conditions
  Store at below -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
• Reconstitution conditions
  See included datasheet or contact us for more information.
• UniProt number
  P17742
• Other related products
• Test
  Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
• Latin name
  Mus musculus
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Peptidyl-prolyl   Cis-trans   Isomerase   A/Cyclophilin   A/CYPA  
• Gene symbol
  PPIA
• Short name
  Recombinant Mouse Peptidyl-prolyl Cis-trans Isomerase A/Cyclophilin A/CYPA
• Technique
  Recombinant, Mouse, mouses, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Host
  mouse
• Species
  Mouse, Mouses
• Alternative name
  Recombinant Mouse CYPA
• Alternative technique
  rec, murine

Gene info

• Identity
  HGNC:9253
• Gene
  PPIA
• Long gene name
  peptidylprolyl isomerase A
• Synonyms
  • CYPA
• Synonyms name
  • cyclophilin A
• GenBank acession
  • X52851
• Locus
  7p13
• Discovery year
  1991-12-06
• Entrez gene record
  5478
• Pubmed identfication
  • 1989998
  • 2197089
• RefSeq identity
  • NM_021130
• Classification
  • Cyclophilin peptidylprolyl isomerases
• VEGA ID
  OTTHUMG00000023687

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products