Recombinant Mouse Host Cell Factor 2/HCFC2 (N-6His)

  • Catalog number
    CH90-1000
  • Price
    Please ask
  • Size
    1 mg
  • Description
    Recombinant Mouse Host cell factor 2 is produced by our E.coli expression system and the target gene encoding Met1-Glu497 is expressed with a 6His tag at the N-terminus.
  • Species reactivity
    Mouse
  • Origin
    Escherichia coli
  • Peptide sequence
    MNHKVHHHHHHMAAPSLLNWRRVSSFTGPVPRARHGHRAVAIRELMIIFGGGNEGIADELHVYNTVTNQWFLPAVRGDIPPGCAAHGFVCDGTRILVFGGMVEYGRYSNELYELQASRWLWKKVKPQPPPSGFPPCPRLGHSFSLYGNKCYLFGGLANESEDSNNNVPRYLNDFYELELQHGSGVVGWSIPATKGVVPSPRESHTAIIYCKKDSASPKMYVFGGMCGARLDDLWQLDLETMSWSKPETKGTVPLPRSLHTASVIGNKMYIFGGWVPHKGENPETSPHDCEWRCTSSFSYLNLDTAEWTTLVSDSQEDKKNSRPRPRAGHCAVAIGTRLYFWSGRDGYKKALNSQVCCKDLWYLDTEKPPAPSQVQLIKATTNSFHVKWDEVPTVEGYLLQLNTDLTYQATSSDSSAAPSVLGGRMDPHRQGSNSTLHNSVSDTVNSTKTEHTAVRGTSLRSKPDSRAVDSSAALHSPLAPNTSNNSSWVTDMLRKNE
  • Estimated molecular weight
    55,2 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Dry Ice/ice packs
  • Package form
    Supplied as a 0.2 µm filtered solution of PBS,2MUrea,pH7.4.
  • Storage conditions
    Store at below -20°C, stable for 6 months after receipt.Please minimize freeze-thaw cycles.
  • Reconstitution conditions
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
  • UniProt number
    Q9D968
  • Additional description
    For cells, cell lines and tissues in culture till half confluency. Aplha, transcription related growth factors and stimulating factors or repressing nuclear factors are complex subunits of proteins involved in cell differentiation. Complex subunit associated factors are involved in hybridoma growth, Eosinohils, eritroid proliferation and derived from promotor binding stimulating subunits on the DNA binding complex. NFKB 105 subunit for example is a polypetide gene enhancer of genes in B cells. Most polyclonal antibodies pabs are raised in rabbits as rabbit polyclonal antibodies.
  • Test
    Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
  • Latin name
    Mus musculus
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
    Factor   2/HCFC2   N-6His  
  • Gene symbol
    HCFC2
  • Short name
    Recombinant Mouse Factor 2/HCFC2 (N-6His)
  • Technique
    Recombinant, Mouse, mouses, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Host
    mouse
  • Species
    Mouse, Mouses
  • Alternative name
    Mouse Host cell factor 2/HCFC2(N-6His)
  • Alternative technique
    rec, murine
  • Alternative to gene target
    host cell factor C2, HCFC2 and IDBG-54267 and ENSG00000111727 and 29915, protein binding, nuclei, Hcfc2 and IDBG-179766 and ENSMUSG00000020246 and 67933, HCFC2 and IDBG-637429 and ENSBTAG00000020933 and 505341
  • Tissue
    cell
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee