Recombinant Mouse Fc Receptor-like Protein 1/FCRL1/FcRH1 (C-6His)

• Catalog number
  CP47-50
• Price
  Please ask
• Size
  50 ug

• Description
  Recombinant Mouse Fc receptor-like protein 1 is produced by our expression system and the target gene encoding Ala17-Ser219 is expressed with a 6His tag at the C-terminus.
• Species reactivity
  Mouse
• Origin
  Human cells
• Peptide sequence
  AGISDVSLKTRPPGGWVMEGDKLVLICSVDRVTGNITYFWYRGALGFQLETKTQPSLTAEFEISDMKQSDADQYYCAANDGHDPIASELVSIHVRVPVSRPVLTFGDSGTQAVLGDLVELHCKALRGSPPIFYQFYHESIILGNSSAPSGGGASFNFSLTAEHSGNFSCEASNGQGAQRSEVVALNLTGLSLVPTENGISHLSHHHHHH
• Estimated molecular weight
  22.5
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Ambient/Room Temperature
• Package form
  Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4.
• Storage conditions
  Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
• Reconstitution conditions
  Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• UniProt number
  Q8R4Y0
• Other related products
• Test
  Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
• Latin name
  Mus musculus
• Additional description
  The receptors are ligand binding factors of type 1, 2 or 3 and protein-molecules that receive chemical-signals from outside a cell. When such chemical-signals couple or bind to a receptor, they cause some form of cellular/tissue-response, e.g. a change in the electrical-activity of a cell. In this sense, am olfactory receptor is a protein-molecule that recognizes and responds to endogenous-chemical signals, chemokinesor cytokines e.g. an acetylcholine-receptor recognizes and responds to its endogenous-ligand, acetylcholine. However, sometimes in pharmacology, the term is also used to include other proteins that are drug-targets, such as enzymes, transporters and ion-channels.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Receptor-like   Protein   1/FCRL1/FcRH1   C-6His  
• Gene symbol
  FCRL1
• Short name
  Recombinant Mouse Fc Receptor-like Protein 1/FCRL1/FcRH1 (C-6His)
• Technique
  Recombinant, Mouse, FC, mouses, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Host
  mouse
• Species
  Mouse, Mouses
• Alternative name
  Mouse FCRL1 (C-6His)
• Alternative technique
  rec, murine
• Alternative to gene target
  Fc receptor-like 1, FCRL1 and IDBG-103709 and ENSG00000163534 and 115350, protein binding, Plasma membranes, Fcrl1 and IDBG-157118 and ENSMUSG00000059994 and 229499, FCRL1 and IDBG-631097 and ENSBTAG00000005891 and 517846

Gene info

• Identity
  HGNC:18509
• Gene
  FCRL1
• Long gene name
  Fc receptor like 1
• Synonyms gene name
  • Fc receptor-like 1
• Synonyms
  • FCRH1
  • IRTA5
  • IFGP1
  • CD307a
• GenBank acession
  • BC033690
• Locus
  1q23.1
• Discovery year
  2005-03-22
• Entrez gene record
  115350
• Pubmed identfication
  • 11493702
  • 11929751
• RefSeq identity
  • NM_052938
• Classification
  • CD molecules
  • Immunoglobulin like domain containing
• VEGA ID
  OTTHUMG00000019398

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products