Recombinant Mouse Epidermal Growth Factor/EGF (C-6His)

• Catalog number
  CH28-10
• Price
  Please ask
• Size
  10 ug

• Description
  Recombinant Mouse epidermal growth factor is produced by our E.coli expression system and the target gene encoding Asn977-Arg1029 is expressed with a 6His tag at the C-terminus.
• Species reactivity
  Mouse
• Origin
  Escherichia coli
• Peptide sequence
  MNSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELRLEHHHHHH
• Estimated molecular weight
  7,2 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Ambient/Room Temperature
• Package form
  Lyophilized from a 0.2 µm filtered solution of PBS,pH7.4.
• Storage conditions
  Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
• Reconstitution conditions
  See included datasheet or contact us for more information.
• UniProt number
  P01132
• Other related products
• Additional description
  Aplha, transcription related growth factors and stimulating factors or repressing nuclear factors are complex subunits of proteins involved in cell differentiation. Complex subunit associated factors are involved in hybridoma growth, Eosinohils, eritroid proliferation and derived from promotor binding stimulating subunits on the DNA binding complex. NFKB 105 subunit for example is a polypetide gene enhancer of genes in B cells.
• Test
  Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
• Latin name
  Mus musculus
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Epidermal   Growth   Factor/EGF   C-6His  
• Gene symbol
  EGF
• Short name
  Recombinant Mouse Epidermal Growth Factor/EGF (C-6His)
• Technique
  Recombinant, Mouse, mouses, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Host
  mouse
• Species
  Mouse, Mouses
• Alternative name
  Mouse EGF(C-6His)
• Alternative technique
  rec, murine
• Alternative to gene target
  epidermal growth factor, HOMG4 and URG, EGF and IDBG-34100 and ENSG00000138798 and 1950, transmembrane receptor protein tyrosine kinase activator activity, Extracellular, Egf and IDBG-193432 and ENSMUSG00000028017 and 13645

Gene info

• Identity
  HGNC:3229
• Gene
  EGF
• Long gene name
  epidermal growth factor
• Synonyms gene name
  • epidermal growth factor (beta-urogastrone)
• Synonyms name
  • Pro-epidermal growth factor
• GenBank acession
  • X04571
• Locus
  4q25
• Discovery year
  2001-06-22
• Entrez gene record
  1950
• VEGA ID
  OTTHUMG00000132044

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products