Recombinant Mouse CD83/HB15 (C-6His)

• Catalog number
  CM53-10
• Price
  Please ask
• Size
  10 ug

• Description
  Recombinant Mouse CD83 is produced by our Mammalian expression system and the target gene encoding Met22-Ala134 is expressed with a 6His tag at the C-terminus.
• Species reactivity
  Mouse
• Origin
  Human cells
• Peptide sequence
  MREVTVACSETADLPCTAPWDPQLSYAVSWAKVSESGTESVELPESKQNSSFEAPRRRAYSLTIQNTTICSSGTYRCALQELGGQRNLSGTVVLKVTGCPKEATESTFRKYRAVDHHHHHH
• Estimated molecular weight
  17,4 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Ambient/Room Temperature
• Package form
  Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4.
• Storage conditions
  Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
• Reconstitution conditions
  See included datasheet or contact us for more information.
• UniProt number
  O88324
• Other related products
• Test
  Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
• Latin name
  Mus musculus
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  CD83/HB15   C-6His  
• Gene symbol
  CD83
• Short name
  Recombinant Mouse CD83/HB15 (C-6His)
• Technique
  Recombinant, Mouse, mouses, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Host
  mouse
• Species
  Mouse, Mouses
• Alternative name
  Mouse CD83/HB15(C-6His)
• Alternative technique
  rec, murine
• Alternative to gene target
  CD83 molecule, BL11 and HB15, CD83 and IDBG-62750 and ENSG00000112149 and 9308, protein binding, Cell surfaces, Cd83 and IDBG-147707 and ENSMUSG00000015396 and 12522, CD83 and IDBG-636028 and ENSBTAG00000031430 and 617034

Gene info

• Identity
  HGNC:1703
• Gene
  CD83
• Long gene name
  CD83 molecule
• Synonyms gene name
  • CD83 antigen (activated B lymphocytes, immunoglobulin superfamily)
  • CD83 molecule
• Synonyms
  • HB15
  • BL11
• GenBank acession
  • Z11697
• Locus
  6p23
• Discovery year
  1999-03-26
• Entrez gene record
  9308
• Pubmed identfication
  • 1378080
  • 8422464
• Classification
  • CD molecules
  • V-set domain containing
• VEGA ID
  OTTHUMG00000014283

Product images

Similar products