Recombinant Mouse CD28//TP44 (C-Fc-6His)

• Catalog number
  CI67-10
• Price
  Please ask
• Size
  10 ug

• Description
  Recombinant Mouse CD28 is produced by our Mammalian expression system and the target gene encoding Asn20-Lys149 is expressed with a Fc, 6His tag at the C-terminus.
• Species reactivity
  Mouse
• Origin
  Human cells
• Peptide sequence
  NKILVKQSPLLVVDSNEVSLSCRYSYNLLAKEFRASLYKGVNSDVEVCVGNGNFTYQPQFRSNAEFNCDGDFDNETVTFRLWNLHVNHTDIYFCKIEFMYPPPYLDNERSNGTIIHIKEKHLCHTQSSPKVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
• Estimated molecular weight
  43 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Ambient/Room Temperature
• Package form
  Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4.
• Storage conditions
  Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
• Reconstitution conditions
  See included datasheet or contact us for more information.
• UniProt number
  P31041
• Other related products
• Test
  Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
• Latin name
  Mus musculus
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  CD28//TP44   C-Fc-6His  
• Gene symbol
  CD28
• Short name
  Recombinant Mouse CD28//TP44 (C-Fc-6His)
• Technique
  Recombinant, Mouse, FC, mouses, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Host
  mouse
• Species
  Mouse, Mouses
• Alternative name
  Mouse CD28/TP44(C-Fc-6His)
• Alternative technique
  rec, murine
• Alternative to gene target
  CD28 molecule, Tp44, CD28 and IDBG-79183 and ENSG00000178562 and 940, identical protein binding, Cell surfaces, Cd28 and IDBG-159608 and ENSMUSG00000026012 and 12487, CD28 and IDBG-643371 and ENSBTAG00000007445 and 281050

Gene info

• Identity
  HGNC:1653
• Gene
  CD28
• Long gene name
  CD28 molecule
• Synonyms gene name
  • CD28 antigen (Tp44)
• Synonyms name
  • T-cell-specific surface glycoprotein
• GenBank acession
  • J02988
• Locus
  2q33.2
• Discovery year
  1988-05-11
• Entrez gene record
  940
• Pubmed identfication
  • 1355979
• RefSeq identity
  • NM_006139
• Classification
  • CD molecules
  • Ig-like cell adhesion molecule family
  • V-set domain containing
• VEGA ID
  OTTHUMG00000132878

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products