Recombinant Mouse BMP Receptor IA/ALK-3/CD292 (C-Fc-6His)

  • Catalog number
    CJ03-50
  • Price
    Please ask
  • Size
    50 ug
  • Description
    Recombinant Mouse BMP Receptor IA is produced by our Mammalian expression system and the target gene encoding Gln24-Arg152 is expressed with a Fc, 6His tag at the C-terminus.
  • Species reactivity
    Mouse
  • Origin
    Human cells
  • Peptide sequence
    QNLDSMLHGTGMKSDLDQKKPENGVTLAPEDTLPFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLTSGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPPVVIGPFFDGSIRVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
  • Estimated molecular weight
    42,2 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Ambient/Room Temperature
  • Package form
    Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4.
  • Storage conditions
    Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
  • Reconstitution conditions
    See included datasheet or contact us for more information.
  • UniProt number
    P36895
  • Test
    Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
  • Latin name
    Mus musculus
  • Additional description
    The receptors are ligand binding factors of type 1, 2 or 3 and protein-molecules that receive chemical-signals from outside a cell. When such chemical-signals couple or bind to a receptor, they cause some form of cellular/tissue-response, e.g. a change in the electrical-activity of a cell. In this sense, am olfactory receptor is a protein-molecule that recognizes and responds to endogenous-chemical signals, chemokinesor cytokines e.g. an acetylcholine-receptor recognizes and responds to its endogenous-ligand, acetylcholine. However, sometimes in pharmacology, the term is also used to include other proteins that are drug-targets, such as enzymes, transporters and ion-channels.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    BMPR1A, ALK, GDF11, GDF10, BMPR2, ENPP7, BMP1, GDF2, MIR1302-3, MIR509-3
  • Short name
    Recombinant Mouse BMP Receptor IA/ALK-3/CD292 (C-Fc-6His)
  • Technique
    Recombinant, Mouse, FC, mouses, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Host
    mouse
  • Species
    Mouse, Mouses
  • Alternative name
    Mouse BMP Receptor IA/ALK-3/CD292(C-Fc-6His)
  • Alternative technique
    rec, murine
  • Alternative to gene target
    anaplastic lymphoma receptor tyrosine kinase, CD246 and NBLST3, ALK and IDBG-42084 and ENSG00000171094 and 238, transferase activity, Plasma membranes, Alk and IDBG-197259 and ENSMUSG00000055471 and 11682, ALK and IDBG-636042 and ENSBTAG00000007379 and 536642
Gene info
Gene info
  • Identity
  • Gene
    ALK
  • Long gene name
    ALK receptor tyrosine kinase
  • Synonyms gene name
    • anaplastic lymphoma kinase (Ki-1)
    • anaplastic lymphoma receptor tyrosine kinase
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    1993-08-24
  • Entrez gene record
    238
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • Receptor tyrosine kinases
    • CD molecules
  • VEGA ID
  • Locus Specific Databases
Gene info
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    bone morphogenetic protein receptor type 2
  • Synonyms gene
  • Synonyms gene name
    • primary pulmonary hypertension 1
    • bone morphogenetic protein receptor, type II (serine/threonine kinase)
    • bone morphogenetic protein receptor type II
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    1997-03-19
  • Entrez gene record
    659
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • Type 2 receptor serine/threonine kinases
  • VEGA ID
  • Locus Specific Databases
Gene info
Gene info
Gene info
Gene info
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee