Recombinant Mouse Anterior Gradient Protein 3/Agr3 (C-6His)

  • Catalog number
    CU52-1000
  • Price
    Please ask
  • Size
    1 mg
  • Description
    Recombinant Mouse Anterior Gradient Protein 3 is produced by our Mammalian expression system and the target gene encoding Ile21-Leu165 is expressed with a 6His tag at the C-terminus.
  • Species reactivity
    Mouse
  • Origin
    Human Cells
  • Peptide sequence
    IAIKKEKRPPQTLSRGWGDDITWVQTYEEGLFHARKSNKPLMVIHHLEDCQYCQALKKEFAKNEEIQEMAQNDFIMLNLMHETTDKNLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYTYEPQDLPMLVDNMKKALRLIQSELVDHHHHHH
  • Estimated molecular weight
    18,1 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Dry Ice/ice packs
  • Package form
    Supplied as a 0.2 µm filtered solution of 20mM Tris,10%Glycerol,100mM NaCl,pH8.0.
  • Storage conditions
    Store at below -20°C, stable for 6 months after receipt.Please minimize freeze-thaw cycles.
  • Reconstitution conditions
    See included datasheet or contact us for more information.
  • UniProt number
    Q8R3W7
  • Test
    Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
  • Latin name
    Mus musculus
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Short name
    Recombinant Mouse Anterior Gradient Protein 3/Agr3 (C-6His)
  • Technique
    Recombinant, Mouse, mouses, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Host
    mouse
  • Species
    Mouse, Mouses
  • Alternative name
    Recombinant Mouse Agr3 (C-6His)
  • Alternative technique
    rec, murine
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee