Recombinant Human Zinc Finger Protein 70/ZNF70 (N-6His)

• Catalog number
  CE70-500
• Price
  Please ask
• Size
  500 ug

• Description
  Recombinant Human Zinc Finger Protein 70 is produced by our E.coli expression system and the target gene encoding Met1-Leu446 is expressed with a 6His tag at the N-terminus.
• Species reactivity
  Human
• Origin
  Escherichia coli
• Peptide sequence
  MGSSHHHHHHSSGLVPRGSHMEVPPATKFGETFAFENRLESQQGLFPGEDLGDPFLQERGLEQMAVIYKEIPLGEQDEENDDYEGNFSLCSSPVQHQSIPPGTRPQDDELFGQTFLQKSDLSMCQIIHSEEPSPCDCAETDRGDSGPNAPHRTPQPAKPYACRECGKAFSQSSHLLRHLVIHTGEKPYECCECGKAFSQSSHLLRHQIIHTGEKPYECRECGKAFRQSSALTQHQKIHTGKRPYECRECGKDFSRSSSLRKHERIHTGERPYQCKECGKSFNQSSGLSQHRKIHTLKKPHECDLCGKAFCHRSHLIRHQRIHTGKKPYKCDECGKAFSQSSNLIEHRKTHTGEKPYKCQKCGKAFSQSSSLIEHQRIHTGEKPYECCQCGKAFCHSSALIQHQRIHTGKKPYTCECGKAFRHRSALIEHYKTHTREKPYVCNLCGKSFRGSSHLIRHQKIHSGEKL
• Estimated molecular weight
  53 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Ambient/Room Temperature
• Package form
  Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, 1mM DTT, pH 7.2.
• Storage conditions
  Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
• Reconstitution conditions
  Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• UniProt number
  Q9UC06
• Other related products
• Additional description
  Finger like and finger proteins are like zinc fingers small proteins with a structural motif that is characterized by the coordination of one or more zinc ions in order to stabilize the fold. Homeobox and homeodomain families.
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Zinc   Finger   Protein   70/ZNF70   N-6His  
• Gene symbol
  ZNF70
• Short name
  Recombinant Zinc Finger Protein 70/ZNF70 (N-6His)
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Species
  Human, Humans
• Alternative name
  Human Zinc Finger Protein 70/ZNF70(N-6His)
• Alternative technique
  rec

Gene info

• Identity
  HGNC:13140
• Gene
  ZNF70
• Long gene name
  zinc finger protein 70
• Synonyms gene name
  • zinc finger protein 70 (Cos17)
• Synonyms
  • Cos17
  • MGC48959
• GenBank acession
  • X60077
• Locus
  22q11.23
• Discovery year
  1991-11-28
• Entrez gene record
  7621
• Pubmed identfication
  • 1639391
• RefSeq identity
  • NM_021916
• Classification
  • Zinc fingers C2H2-type
• VEGA ID
  OTTHUMG00000150739

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products