Recombinant Human Leukocyte Surface Antigen CD47/IAP/OA3 (C-Fc)

  • Catalog number
    CG18-1000
  • Price
    Please ask
  • Size
    1 mg
  • Description
    Recombinant Human CD47 is produced by our Mammalian expression system and the target gene encoding Gln19-Pro139 is expressed with a Fc tag at the C-terminus.
  • Species reactivity
    Human
  • Origin
    Human Cells
  • Peptide sequence
    QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
  • Estimated molecular weight
    40,8 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Ambient/Room Temperature
  • Package form
    Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4.
  • Storage conditions
    Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at below -20°C for 3 months.
  • Reconstitution conditions
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
  • UniProt number
    Q08722
  • Additional description
    Antigens are peptides or recombinant or native dependent on the production method.
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    CD47, ALPI, IAPP, MAGT1, BIRC7
  • Short name
    Recombinant Leukocyte Surface Antigen CD47/IAP/OA3 (C-Fc)
  • Technique
    Recombinant, antigen, FC, antigenes, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Species
    Human, Humans
  • Alternative name
    Human CD47/IAP/OA3(C-Fc)
  • Alternative technique
    rec, antigenes
  • Alternative to gene target
    CD47 molecule, IAP and MER6 and OA3, CD47 and IDBG-48744 and ENSG00000196776 and 961, thrombospondin receptor activity, Plasma membranes, Cd47 and IDBG-165137 and ENSMUSG00000055447 and 16423, CD47 and IDBG-631689 and ENSBTAG00000003585 and 282661
Gene info
Gene info
Gene info
Gene info
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The number of CD4-POSITIVE T-LYMPHOCYTES per unit volume of BLOOD. Determination requires the use of a fluorescence-activated flow cytometer.
  • Tree numbers
    • E01.370.225.500.195.107.595.500.150
    • E01.370.225.625.107.595.500.150
    • E05.200.500.195.107.595.500.150
    • E05.200.625.107.595.500.150
    • E05.242.195.107.595.500.150
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee