Recombinant Human ß-2-Microglobulin/B2M (N-6His)

• Catalog number
  CH02-50
• Price
  Please ask
• Size
  50 ug

• Description
  Recombinant Human beta-2-Microglobulin is produced by our E.coli expression system and the target gene encoding Ile21-Met119 is expressed with a 6His tag at the N-terminus.
• Species reactivity
  Human
• Origin
  Escherichia coli
• Peptide sequence
  MGSSHHHHHHSSGLVPRGSHMIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM
• Estimated molecular weight
  14 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Ambient/Room Temperature
• Package form
  Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4.
• Storage conditions
  Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
• Reconstitution conditions
  See included datasheet or contact us for more information.
• UniProt number
  P61769
• Other related products
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  ß-2-Microglobulin/B2M   N-6His  
• Gene symbol
  B2M
• Short name
  Recombinant ß-2-Microglobulin/B2M (N-6His)
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Species
  Humans
• Alternative name
  Human beta-2-Microglobulin/B2M(N-6His)
• Alternative technique
  rec
• Alternative to gene target
  beta-2-microglobulin, B2M and IDBG-9902 and ENSG00000166710 and 567, identical protein binding, Extracellular, B2m and IDBG-202736 and ENSMUSG00000060802 and 12010, B2M and IDBG-646936 and ENSBTAG00000012330 and 280729,783680

Gene info

• Identity
  HGNC:914
• Gene
  B2M
• Long gene name
  beta-2-microglobulin
• GenBank acession
  • AB021288
• Locus
  15q21.1
• Discovery year
  2001-06-22
• Entrez gene record
  567
• RefSeq identity
  • NM_004048
• Classification
  • C1-set domain containing
• VEGA ID
  OTTHUMG00000131247
• Locus Specific Databases
  • LRG_1215

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products