Recombinant Human SOD2/Mn-SOD (C-6His, Human Cells)

  • Catalog number
    CB01-10
  • Price
    Please ask
  • Size
    10 ug
  • Description
    Recombinant Human SOD2 is produced by our Mammalian expression system and the target gene encoding Lys25-Lys222 is expressed with a 6His tag at the C-terminus.
  • Species reactivity
    Human
  • Origin
    Human cells
  • Peptide sequence
    KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKKVDHHHHHH
  • Estimated molecular weight
    23,24 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Dry Ice/ice packs
  • Package form
    Supplied as a 0.2 µm filtered solution of 20mM Tris,150mM NaCl,pH8.0.
  • Storage conditions
    Store at below -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
  • Reconstitution conditions
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
  • UniProt number
    P04179
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    SOD3, SOD2-OT1, SOD2, GCASPC
  • Short name
    Recombinant SOD2/Mn-SOD (C-6His, Cells)
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Species
    Human, Humans
  • Alternative name
    Human SOD2/Mn-SOD(C-6His)
  • Alternative technique
    rec
  • Alternative to gene target
    superoxide dismutase 2, mitochondrial, IPOB and MNSOD and MVCD6, SOD2 and IDBG-98553 and ENSG00000112096 and 100129518,6648, metal ion binding, Cytoplasm, Sod2 and IDBG-137806 and ENSMUSG00000006818 and 20656, SOD2 and IDBG-635443 and ENSBTAG00000006523 and 281496
  • Tissue
    cells
Gene info
  • Identity
  • Gene
  • Long gene name
    superoxide dismutase 3
  • Synonyms gene name
    • superoxide dismutase 3, extracellular
  • Synonyms
  • Locus
  • Discovery year
    1988-05-08
  • Entrez gene record
  • Classification
    • Superoxide dismutases
  • VEGA ID
Gene info
  • Identity
  • Gene
  • Long gene name
    SOD2 overlapping transcript 1
  • Locus
  • Discovery year
    2017-04-19
  • Entrez gene record
  • RefSeq identity
  • Classification
    • Overlapping transcripts
Gene info
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee