Recombinant Human Signaling Lymphocytic Activation Molecule/SLAM/CD150 (C-6His)

• Catalog number
  C309-1000
• Price
  Please ask
• Size
  1 mg

• Description
  Recombinant Human Signaling Lymphocytic Activation Molecule is produced by our Mammalian expression system and the target gene encoding Ala21-Pro237 is expressed with a 6His tag at the C-terminus.
• Species reactivity
  Human
• Origin
  Human Cells
• Peptide sequence
  ASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSIHIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKEDEGWYLMTLEKNVSVQRFCLQLRLYEQVSTPEIKVLNKTQENGTCTLILGCTVEKGDHVAYSWSEKAGTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPISNNSQTFSPWPGCRTDPSETKPVDHHHHHH
• Estimated molecular weight
  25,33 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Ambient/Room Temperature
• Package form
  Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
• Storage conditions
  Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at below -20°C for 3 months.
• Reconstitution conditions
  Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• UniProt number
  Q13291
• Other related products
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Additional description
  Whole adhesion and interacting molecules are  present in lysates used as reference for ELISA quantification of these molecules and their subunits. Cell nucleus signaling proteins and molecules are part of a complex system of communication that governs basic cellular activities and coordinates cell actions. The ability of cells to perceive and correctly respond to their microenvironment is the basis of development, tissue repair, and immunity as well as normal tissue homeostasis. Errors in cellular information processing are responsible for diseases such as cancer, autoimmunity, and diabetes. By understanding cell signaling, diseases may be treated effectively and, theoretically, artificial tissues may be created.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Signaling   Lymphocytic   Activation   Molecule/SLAM/CD150   C-6His  
• Gene symbol
  SLAMF1
• Short name
  Recombinant Signaling Lymphocytic Activation Molecule/SLAM/CD150 (C-6His)
• Technique
  Recombinant, activation, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Species
  Human, Humans
• Alternative name
  Human SLAM/CD150(C-6His)
• Alternative technique
  rec

Gene info

• Identity
  HGNC:10903
• Gene
  SLAMF1
• Long gene name
  signaling lymphocytic activation molecule family member 1
• Synonyms gene
  • SLAM
• Synonyms gene name
  • signaling lymphocytic activation molecule
• Synonyms
  • CD150
• GenBank acession
  • U33017
• Locus
  1q23.3
• Discovery year
  1998-08-06
• Entrez gene record
  6504
• Pubmed identfication
  • 7617038
• Classification
  • CD molecules
  • Immunoglobulin like domain containing
  • Ig-like cell adhesion molecule family
• VEGA ID
  OTTHUMG00000024006

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products