Recombinant Human Signal Transducer and Activator of Transcription 5B/STAT5B (C-6His)
-
Catalog number
CG38-10
-
Price
Please ask
-
Size
10 ug
-
-
Description
Recombinant Human STAT5B is produced by our E.coli expression system and the target gene encoding Met1-Thr321 is expressed with a 6His tag at the C-terminus.
-
Species reactivity
Human
-
Origin
Escherichia coli
-
Peptide sequence
MAVWIQAQQLQGEALHQMQALYGQHFPIEVRHYLSQWIESQAWDSVDLDNPQENIKATQLLEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLVREANNGSSPAGSLADAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESLRIQAQFGPLAQLSPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLLRKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLCQQLPIPGPVEEMLAEVNATITLEHHHHHH
-
Estimated molecular weight
38,4 kDa
-
Protein purity
Greater than 95% as determined by reducing SDS-PAGE.
-
Endotoxin level
Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
-
Shipping condition
Dry ice/ice packs
-
Package form
Supplied as a 0.2 µm filtered solution of PBS, 50% Glycerol, 1mM DTT, pH 7.4.
-
Storage conditions
Store at below -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
-
Reconstitution conditions
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
-
UniProt number
P51692
-
-
Properties
Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
-
Source
Recombinants or rec. proteins
-
Group
recombinants
-
Additional description
The activation of transcription factor subunits is the first step of gene expression, in which a particular segment of DNA is copied into RNA (mRNA) by the enzyme RNA polymerases. Transcription factors, unites and elongations can be RNA and DNA nucleic acids, base pairs of nucleotides . Converting from DNA to RNA is made by enzymatic reactions. During transcription, a DNA sequence is read by an RNA polymerase, which produces a complementary, anti-parallel RNA strand called a primary transcript. Transcriptions are key functions in signal transduction pathways. Signaling ligand binding transcription factors play an important role in transduction cascades.
-
Gene target
-
Gene symbol
STAT5B
-
Short name
Recombinant Signal Transducer Activator of Transcription 5B/STAT5B (C-6His)
-
Technique
Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
-
Species
Human, Humans
-
Alternative name
Human STAT5B(C-6His)
-
Alternative technique
rec
-
Alternative to gene target
signal transducer and activator of transcription 5B, STAT5, STAT5B and IDBG-50532 and ENSG00000173757 and 102723386,6777, protein dimerization activity, nuclei, Stat5b and IDBG-211594 and ENSMUSG00000020919 and 20851, STAT5B and IDBG-640180 and ENSBTAG00000010125 and 282376,789476
-
Gene info
MeSH Data
-
Name
-
Concept
Scope note:
The initial culturing of cells derived directly from fresh TISSUES.
-
Tree numbers
- E01.370.225.500.223.500
- E05.200.500.265.500
- E05.242.223.500
- E05.481.500.249.500
-
Qualifiers
ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
