Recombinant Human Serum Amyloid A1/SAA1 (N-6His)

• Catalog number
  C633-1000
• Price
  Please ask
• Size
  1 mg

• Description
  Recombinant Human Serum Amyloid A1 Protein is produced by our E.coli expression system and the target gene encoding Arg19-Tyr122 is expressed with a 6His tag at the N-terminus.
• Species reactivity
  Human
• Origin
  Escherichia coli
• Peptide sequence
  MNHKVHHHHHHMRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAADEWGRSGKDPNHFRPAGLPEKY
• Estimated molecular weight
  13,2 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Ambient/Room Temperature
• Package form
  Lyophilized from a 0.2 µm filtered solution of 20mM TrisHCl,150mM NaCl,1mM EDTA, pH 8.0.
• Storage conditions
  Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at below -20°C for 3 months.
• Reconstitution conditions
  Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• UniProt number
  P0DJI8
• Other related products
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Source
  Recombinants or rec. proteins
• Group
  recombinants, Sera
• Additional description
  Azide Free Serum for cell culture FBS fetal bovine serum. Filtered serum for sterility. The polyclonal serum contains no red or white blood cells or clotting factors; it is the blood plasma not including the fibrinogens. Serum includes all proteins and antibodies not used in blood clotting (coagulation) and all the electrolytes, antibodies, antigens, hormones, and any exogenous substances like drugs and microorganisms. Plasmas on request.
• About
  Serum should be stored at +5°C

• Gene target
  Amyloid   A1/SAA1   N-6His  
• Gene symbol
  SAA1
• Short name
  Recombinant Serum Amyloid A1/SAA1 (N-6His)
• Technique
  Recombinant, serum, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Species
  Human, Humans
• Alternative name
  Human Serum Amyloid A1/SAA1(N-6His)
• Alternative technique
  rec, sera
• Alternative to gene target
  serum amyloid A1, PIG4 and SAA and SAA2 and TP53I4, SAA1 and IDBG-34659 and ENSG00000173432 and 6288, heparin binding, Extracellular
• Tissue
  serum

Gene info

• Identity
  HGNC:10513
• Gene
  SAA1
• Long gene name
  serum amyloid A1
• Synonyms gene
  • SAA
• Synonyms
  • PIG4
  • TP53I4
• GenBank acession
  • M10906
• Locus
  11p15.1
• Discovery year
  1988-01-18
• Entrez gene record
  6288
• Pubmed identfication
  • 2595451
  • 9305847
• RefSeq identity
  • NM_199161
• Classification
  • Receptor ligands
• VEGA ID
  OTTHUMG00000166147

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products