Recombinant Human Sentrin-Specific Protease 8/SENP8 (N-6His)

• Catalog number
  C172-500
• Price
  Please ask
• Size
  500 ug

• Description
  Recombinant Human Sentrin-Specific Protease 8 is produced by our E.coli expression system and the target gene encoding Met1-Lys212 is expressed with a 6His tag at the N-terminus.
• Species reactivity
  Human
• Origin
  Escherichia coli
• Peptide sequence
  MGSSHHHHHHSSGLVPRGSHMDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVSFISPEVTQFIKCTSNPAEIAMFLEPLDLPNKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDSHSRSNSVHAKQVAEKLEAFLGRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFRQQTESLLQLLTPAYITKKRGEWKDLIATLAKK
• Estimated molecular weight
  26,24 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Dry ice/ice packs
• Package form
  Supplied as a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
• Storage conditions
  Store at below -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
• Reconstitution conditions
  See included datasheet or contact us for more information.
• UniProt number
  Q96LD8
• Other related products
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Sentrin-Specific   Protease   8/SENP8   N-6His  
• Gene symbol
  SENP8
• Short name
  Recombinant Sentrin-Specific Protease 8/SENP8 (N-6His)
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Species
  Human, Humans
• Alternative name
  Human Sentrin-Specific Protease 8/SENP8(N-6His)
• Alternative technique
  rec

Gene info

• Identity
  HGNC:22992
• Gene
  SENP8
• Long gene name
  SUMO peptidase family member, NEDD8 specific
• Synonyms gene
  • PRSC2
• Synonyms gene name
  • protease, cysteine, 2 (NEDD8 specific)
  • SUMO/sentrin specific protease family member 8
  • SUMO/sentrin specific peptidase family member 8
  • SUMO/sentrin peptidase family member, NEDD8 specific
• Synonyms
  • NEDP1
  • DEN1
  • HsT17512
• Synonyms name
  • NEDD8-specific protease 1
  • sentrin/SUMO-specific protease SENP8
  • deneddylase 1
• GenBank acession
  • BC031411
• Locus
  15q23
• Discovery year
  2003-09-02
• Entrez gene record
  123228
• Pubmed identfication
  • 12730221
  • 12759362
• RefSeq identity
  • NM_145204
• Classification
  • SUMO specific peptidases
• VEGA ID
  OTTHUMG00000133441

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products