Recombinant Human S100A7

• Catalog number
  CR28-1000
• Price
  Please ask
• Size
  1 mg

• Description
  Recombinant Human S100A7 is produced by our E.coli expression system and the target gene encoding Met1-Gln101 is expressed.
• Species reactivity
  Human
• Origin
  Escherichia coli
• Peptide sequence
  MSNTQAERSIIGMIDMFHKYTRRDDKIEKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ
• Estimated molecular weight
  11.5
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Ambient/Room Temperature
• Package form
  Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4.
• Storage conditions
  Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at below -20°C for 4 months.
• Reconstitution conditions
  See included datasheet or contact us for more information.
• UniProt number
  P31151
• Other related products
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  S100A7  
• Gene symbol
  S100A7
• Short name
  Recombinant S100A7
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Species
  Human, Humans
• Alternative name
  Recombinant Human S100A7
• Alternative technique
  rec
• Alternative to gene target
  S100 calcium binding protein A7, PSOR1 and S100A7c, S100A7 and IDBG-102676 and ENSG00000143556 and 6278, RAGE receptor binding, nuclei

Gene info

• Identity
  HGNC:10497
• Gene
  S100A7
• Long gene name
  S100 calcium binding protein A7
• Synonyms gene
  • PSOR1
• Synonyms gene name
  • S100 calcium-binding protein A7 (psoriasin 1)
  • S100 calcium binding protein A7 (psoriasin 1)
• Synonyms
  • S100A7c
• GenBank acession
  • BC034687
• Locus
  1q21.3
• Discovery year
  1992-10-08
• Entrez gene record
  6278
• Pubmed identfication
  • 1940442
• RefSeq identity
  • NM_002963
• Classification
  • S100 calcium binding proteins
  • EF-hand domain containing
• VEGA ID
  OTTHUMG00000013123

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products