Recombinant Human S100 Calcium Binding Protein A6/S100A6 (N-6His)

  • Catalog number
    CH98-10
  • Price
    Please ask
  • Size
    10 ug
  • Description
    Recombinant Human S100 calcium binding protein A is produced by our E.coli expression system and the target gene encoding Met1-Gly90 is expressed with a 6His tag at the N-terminus.
  • Species reactivity
    Human
  • Origin
    Escherichia coli
  • Peptide sequence
    MGSSHHHHHHSSGLVPRGSHMMACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG
  • Estimated molecular weight
    12,5 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Dry Ice/ice packs
  • Package form
    Supplied as a 0.2 µm filtered solution of PBS,pH7.4.
  • Storage conditions
    Store at below -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
  • Reconstitution conditions
    See included datasheet or contact us for more information.
  • UniProt number
    P06703
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    S100A6, S100A1, S100Z, S100A8, S100A9
  • Short name
    Recombinant S100 Calcium Binding Protein A6/S100A6 (N-6His)
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Species
    Human, Humans
  • Alternative name
    Human S100 Calcium Binding Protein A6/S100A6(N-6His)
  • Alternative technique
    rec
Gene info
  • Identity
  • Gene
  • Long gene name
    S100 calcium binding protein A6
  • Synonyms gene
  • Synonyms gene name
    • calcyclin
    • S100 calcium-binding protein A6 (calcyclin)
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    1986-01-01
  • Entrez gene record
  • RefSeq identity
  • Classification
    • S100 calcium binding proteins
    • EF-hand domain containing
  • VEGA ID
Gene info
Gene info
Gene info
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee