Recombinant Human Protein S100-A13/S100A13

  • Catalog number
    CG16-500
  • Price
    Please ask
  • Size
    500 ug
  • Description
    Recombinant Human Protein S100-A13 is produced by our expression system and the target gene encoding Ala2-Lys98 is expressed
  • Species reactivity
    Human
  • Origin
    Escherichia coli
  • Peptide sequence
    AAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK
  • Estimated molecular weight
    11,3 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Ambient/Room Temperature
  • Package form
    Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4.
  • Storage conditions
    Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
  • Reconstitution conditions
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH3O.Please aliquot the reconstituted solution to
  • UniProt number
    Q99584
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    S100A13, SNAR-A13, S100A1, S100Z, S100A8, S100A9
  • Short name
    Recombinant Protein S100-A13/S100A13
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Species
    Human, Humans
  • Alternative name
    Recombinant Human S100A13
  • Alternative technique
    rec
  • Alternative to gene target
    S100 calcium binding protein A13, S100A13 and IDBG-102736 and ENSG00000189171 and 6284, RAGE receptor binding, nuclei, S100a13 and IDBG-167784 and ENSMUSG00000042312 and 20196, S100A13 and IDBG-632825 and ENSBTAG00000021378 and 404146
Gene info
  • Identity
  • Gene
  • Long gene name
    S100 calcium binding protein A13
  • Synonyms gene name
    • S100 calcium-binding protein A13
  • GenBank acession
  • Locus
  • Discovery year
    1997-10-30
  • Entrez gene record
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • S100 calcium binding proteins
  • VEGA ID
Gene info
  • Identity
  • Gene
  • Long gene name
    small NF90 (ILF3) associated RNA A13
  • Synonyms gene name
    • small nuclear ILF3/NF90-associated RNA A13
    • small ILF3/NF90-associated RNA A13
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    2008-06-20
  • Entrez gene record
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • Small NF90 (ILF3) associated RNAs
Gene info
Gene info
Gene info
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee