Recombinant Human Podoplanin/PDPN/Aggrus (C-6His)

• Catalog number
  C528-1000
• Price
  Please ask
• Size
  1 mg

• Description
  Recombinant Human Podoplanin is produced by our Mammalian expression system and the target gene encoding Ala23-Leu131 is expressed with a 6His tag at the C-terminus.
• Species reactivity
  Human
• Origin
  Human Cells
• Peptide sequence
  ASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVATSVNSVTGIRIEDLPTSESTVHAQEQSPSATASNVATSHSTEKVDGDTQTTVEKDGLSTVTLVDHHHHHH
• Estimated molecular weight
  12,16 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Ambient/Room Temperature
• Package form
  Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
• Storage conditions
  Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at below -20°C for 3 months.
• Reconstitution conditions
  Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• UniProt number
  Q86YL7
• Other related products
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Podoplanin/PDPN/Aggrus   C-6His  
• Gene symbol
  PDPN
• Short name
  Recombinant Podoplanin/PDPN/Aggrus (C-6His)
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Species
  Human, Humans
• Alternative name
  Recombinant Human PDPN(C-6His)
• Alternative technique
  rec
• Alternative to gene target
  podoplanin, AGGRUS and GP36 and Gp38 and GP40 and HT1A-1 and OTS8 and PA2.26 and T1A and T1A-2 and T1A2 and TI1A, PDPN and IDBG-90582 and ENSG00000162493 and 10630, Cell surfaces, Pdpn and IDBG-202630 and ENSMUSG00000028583 and 14726, BOVAGGRUS and IDBG-636063 and ENSBTAG00000001788 and 509732

Gene info

• Identity
  HGNC:29602
• Gene
  PDPN
• Long gene name
  podoplanin
• Synonyms
  • T1A-2
  • Gp38
  • aggrus
  • GP40
  • PA2.26
  • D2-40
• Synonyms name
  • lung type I cell membrane associated glycoprotein
• GenBank acession
  • AB127958
  • AY194238
• Locus
  1p36.21
• Discovery year
  2005-07-08
• Entrez gene record
  10630
• Pubmed identfication
  • 10393083
  • 9651190
• RefSeq identity
  • NM_006474
• VEGA ID
  OTTHUMG00000007912

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products