Recombinant Human Platelet Glycoprotein 4/CD36 (C-6His)

• Catalog number
  CU25-10
• Price
  Please ask
• Size
  10 ug

• Description
  Recombinant Human Platelet Glycoprotein 4 is produced by our Mammalian expression system and the target gene encoding Gly30-Asn439 is expressed with a 6His tag at the C-terminus.
• Species reactivity
  Human
• Origin
  Human cells
• Peptide sequence
  GDLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLRELLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRFVLPSKAFASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETGTIGDEKANMFRSQVTGKINHHHHHH
• Estimated molecular weight
  47,4 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Ambient/Room Temperature
• Package form
  Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4.
• Storage conditions
  Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
• Reconstitution conditions
  See included datasheet or contact us for more information.
• UniProt number
  P16671
• Other related products
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Additional description
  Platelets, also called thrombocytes or cloth cells in blood and are needed to stop bleeding by clumping and clotting the blood the vessels when the an injury occurs. Teh bone marrow will produce the platelets that have no nucleus. Platelates are unique to mammals, the are curved shaped 1900nm to 3100 nm large nucleus free clothing structures.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Platelet   Glycoprotein   4/CD36   C-6His  
• Gene symbol
  CD36
• Short name
  Recombinant Platelet Glycoprotein 4/CD36 (C-6His)
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Species
  Human, Humans
• Alternative name
  Recombinant Human CD36 (C-6His)
• Alternative technique
  rec
• Alternative to gene target
  CD36 molecule (thrombospondin receptor), BDPLT10 and CHDS7 and FAT and GP3B and GP4 and GPIV and PASIV and SCARB3, CD36 and IDBG-24023 and ENSG00000135218 and 948, lipoprotein particle binding, Extracellular, Cd36 and IDBG-136838 and ENSMUSG00000002944 and 12491

Gene info

• Identity
  HGNC:1663
• Gene
  CD36
• Long gene name
  CD36 molecule
• Synonyms gene name
  • CD36 antigen (collagen type I receptor, thrombospondin receptor)
  • CD36 molecule (thrombospondin receptor)
• Synonyms
  • SCARB3
  • GPIV
  • FAT
  • GP4
  • GP3B
• GenBank acession
  • Z32770
• Locus
  7q21.11
• Discovery year
  1993-06-04
• Entrez gene record
  948
• Pubmed identfication
  • 7503937
• RefSeq identity
  • NM_001001547
• Classification
  • CD molecules
  • Scavenger receptors
• VEGA ID
  OTTHUMG00000155383

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products