Recombinant Human Peptidyl-Prolyl Cis-Trans Isomerase H/PPIH (N-6His)

• Catalog number
  C253-1000
• Price
  Please ask
• Size
  1 mg

• Description
  Recombinant Human PPIase H is produced by our E.coli expression system and the target gene encoding Met1-Met177 is expressed with a 6His tag at the N-terminus.
• Species reactivity
  Human
• Origin
  Escherichia coli
• Peptide sequence
  MGSSHHHHHHSSGLVPRGSHMAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM
• Estimated molecular weight
  21,4 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Dry ice/ice packs
• Package form
  Supplied as a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
• Storage conditions
  Store at below -20°C, stable for 6 months after receipt.Please minimize freeze-thaw cycles.
• Reconstitution conditions
  Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• UniProt number
  O43447
• Other related products
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Peptidyl-Prolyl   Cis-Trans   Isomerase   H/PPIH   N-6His  
• Gene symbol
  PPIH
• Short name
  Recombinant Peptidyl-Prolyl Cis-Trans Isomerase H/PPIH (N-6His)
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Species
  Human, Humans
• Alternative name
  Human PPIase H/PPIH(N-6His)
• Alternative technique
  rec
• Alternative to gene target
  peptidylprolyl isomerase H (cyclophilin H), PPIH and IDBG-97224 and ENSG00000171960 and 10465, ribonucleoprotein complex binding, nuclei, Ppih and IDBG-182988 and ENSMUSG00000060288 and 433064,66101, PPIH and IDBG-640563 and ENSBTAG00000004590 and 513428

Gene info

• Identity
  HGNC:14651
• Gene
  PPIH
• Long gene name
  peptidylprolyl isomerase H
• Synonyms gene name
  • peptidyl prolyl isomerase H (cyclophilin H)
• Synonyms
  • USA-CYP
  • CYP-20
  • SnuCyp-20
  • CYPH
  • MGC5016
• Synonyms name
  • USA-CyP SnuCyp-20
  • cyclophilin H
  • U-snRNP-associated cyclophilin SunCyp-20
  • small nuclear ribonucleoprotein particle-specific cyclophilin H
  • rotamase H
  • peptidyl-prolyl cis-trans isomerase H
  • PPIase h
• GenBank acession
  • AF016371
• Locus
  1p34.2
• Discovery year
  2001-03-16
• Entrez gene record
  10465
• Pubmed identfication
  • 9404889
  • 9570313
• RefSeq identity
  • NM_006347
• Classification
  • U4/U6 small nuclear ribonucleoprotein
  • Cyclophilin peptidylprolyl isomerases
• VEGA ID
  OTTHUMG00000007520

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products