Recombinant Human Peptidyl-Prolyl Cis-Trans Isomerase FKBP3 (N-6His)

• Catalog number
  CH60-500
• Price
  Please ask
• Size
  500 ug

• Description
  Recombinant Human FKBP25/ is produced by our E.coli expression system and the target gene encoding Met1-Asp224 is expressed with a 6His tag at the N-terminus.
• Species reactivity
  Human
• Origin
  Escherichia coli
• Peptide sequence
  MGSSHHHHHHSSGLVPRGSHMAAAVPQRAWTVEQLRSEQLPKKDIIKFLQEHGSDSFLAEHKLLGNIKNVAKTANKDHLVTAYNHLFETKRFKGTESISKVSEQVKNVKLNEDKPKETKSEETLDEGPPKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTSAKKKKNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID
• Estimated molecular weight
  27,3 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Dry ice/ice packs
• Package form
  Supplied as a 0.2 µm filtered solution of 20mM TrisHCl,1mM DTT,10% glycerol .
• Storage conditions
  Store at below -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
• Reconstitution conditions
  See included datasheet or contact us for more information.
• UniProt number
  Q00688
• Other related products
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Peptidyl-Prolyl   Cis-Trans   Isomerase   FKBP3   N-6His  
• Gene symbol
  FKBP3
• Short name
  Recombinant Peptidyl-Prolyl Cis-Trans Isomerase FKBP3 (N-6His)
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Species
  Human, Humans
• Alternative name
  Human FKBP25/FKBP3(N-6His)
• Alternative technique
  rec
• Alternative to gene target
  FK506 binding protein 3, 25kDa, FKBP-25 and FKBP-3 and FKBP25 and PPIase, FKBP3 and IDBG-5577 and ENSG00000100442 and 2287, poly(A) RNA binding, nuclei, Fkbp3 and IDBG-143170 and ENSMUSG00000020949 and 30795, FKBP3 and IDBG-633002 and ENSBTAG00000002610 and 515069

Gene info

• Identity
  HGNC:3719
• Gene
  FKBP3
• Long gene name
  FKBP prolyl isomerase 3
• Synonyms gene name
  • FK506-binding protein 3 (25kD)
  • FK506 binding protein 3, 25kDa
  • FK506 binding protein 3
• Synonyms
  • FKBP-25
  • FKBP25
• GenBank acession
  • M96256
• Locus
  14q21.2
• Discovery year
  1992-09-14
• Entrez gene record
  2287
• Pubmed identfication
  • 1374240
  • 1532945
• RefSeq identity
  • NM_002013
• Classification
  • FKBP prolyl isomerases
• VEGA ID
  OTTHUMG00000140267

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products