Recombinant Human PDCD4/H731 (C-6His)

  • Catalog number
    CF62-10
  • Price
    Please ask
  • Size
    10 ug
  • Description
    Recombinant Human Programmed Cell Death Protein 4 is produced by our E.coli expression system and the target gene encoding Lys212-Pro357 is expressed with a 6His tag at the C-terminus.
  • Species reactivity
    Human
  • Origin
    Escherichia coli
  • Peptide sequence
    MKASHREMTSKLLSDLCGTVMSTTDVEKSFDKLLKDLPELALDTPRAPQLVGQFIARAVGDGILCNTYIDSYKGTVDCVQARAALDKATVLLSMSKGGKRKDSVWGSGGGQQSVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPLEHHHHHH
  • Estimated molecular weight
    17 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Ambient/Room Temperature
  • Package form
    Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4.
  • Storage conditions
    Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
  • Reconstitution conditions
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
  • UniProt number
    Q53EL6
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    PDCD4, PDCD4-AS1
  • Short name
    Recombinant PDCD4/H731 (C-6His)
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Species
    Human, Humans
  • Alternative name
    Human PDCD4/H731(C-6His)
  • Alternative technique
    rec
  • Alternative to gene target
    programmed cell death 4 (neoplastic transformation inhibitor), PDCD4 and IDBG-89535 and ENSG00000150593 and 100616113,27250, protein binding, nuclei, Pdcd4 and IDBG-176913 and ENSMUSG00000024975 and 18569, PDCD4 and IDBG-639738 and ENSBTAG00000019434 and 506724
Gene info
Gene info
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee