Recombinant Human NKG2D Ligand 2/NKG2DL2/N2DL2 (C-6His)

• Catalog number
  C508-1000
• Price
  Please ask
• Size
  1 mg

• Description
  Recombinant Human NKG2D ligand 2 is produced by our Mammalian expression system and the target gene encoding Gly26-Ser217 is expressed with a 6His tag at the C-terminus.
• Species reactivity
  Human
• Origin
  Human Cells
• Peptide sequence
  GRADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTTAWKAQNPVLREVVDILTEQLRDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSFDGQIFLLFDSEKRMWTTVHPGARKMKEKWENDKVVAMSFHYFSMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSSVDHHHHHH
• Estimated molecular weight
  22,78 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Ambient/Room Temperature
• Package form
  Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
• Storage conditions
  Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at below -20°C for 3 months.
• Reconstitution conditions
  Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• UniProt number
  Q9BZM5
• Other related products
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Additional description
  FAS ligand and other ligands are binding to the receptor for signaling pathways for example in apoptosis or JNK signaling. Receptor agonists are often tested for drug development.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  NKG2D   Ligand   2/NKG2DL2/N2DL2   C-6His  
• Gene symbol
  KLRK1
• Short name
  Recombinant NKG2D Ligand 2/NKG2DL2/N2DL2 (C-6His)
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Species
  Human, Humans
• Alternative name
  Human ULBP-2/NKG2DL2(C-6His)
• Alternative technique
  rec

Gene info

• Identity
  HGNC:18788
• Gene
  KLRK1
• Long gene name
  killer cell lectin like receptor K1
• Synonyms gene
  • D12S2489E
• Synonyms gene name
  • DNA segment on chromosome 12 (unique) 2489 expressed sequence
  • killer cell lectin-like receptor subfamily K, member 1
• Synonyms
  • NKG2D
  • KLR
  • NKG2-D
  • CD314
• GenBank acession
  • AJ001687
• Locus
  12p13.2
• Discovery year
  2003-12-12
• Entrez gene record
  22914
• Pubmed identfication
  • 9683661
  • 2007850
• RefSeq identity
  • NM_007360
• Classification
  • Killer cell lectin like receptors
  • C-type lectin domain containing
  • CD molecules
• VEGA ID
  OTTHUMG00000168574

MeSH Data

• Name
  Electrophoresis, Gel, Two-Dimensional
• Concept
  Scope note: Electrophoresis in which a second perpendicular electrophoretic transport is performed on the separate components resulting from the first electrophoresis. This technique is usually performed on polyacrylamide gels.
• Tree numbers
  • E05.196.401.250
  • E05.301.300.230
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products