Recombinant Human NCR3/NKp30/CD337 (Leu19-Gly135,C-Fc)

• Catalog number
  CC40-10
• Price
  Please ask
• Size
  10 ug

• Description
  Recombinant Human NCR3 is produced by our Mammalian expression system and the target gene encoding Leu19-Gly135 is expressed with a Fc tag at the C-terminus.
• Species reactivity
  Human
• Origin
  Human cells
• Peptide sequence
  LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
• Estimated molecular weight
  39,9 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Ambient/Room Temperature
• Package form
  Lyophilized from a 0.2 µm filtered solution of PBS, pH 7.4 .
• Storage conditions
  Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
• Reconstitution conditions
  Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• UniProt number
  O14931
• Other related products
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  NCR3/NKp30/CD337   Leu19-Gly135   C-Fc  
• Gene symbol
  NCR3
• Short name
  Recombinant NCR3/NKp30/CD337 (Leu19-Gly135 C-Fc)
• Technique
  Recombinant, FC, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Species
  Human, Humans
• Alternative name
  Human NCR3/NKp30/CD337(Leu19-Gly135,C-Fc)
• Alternative technique
  rec
• Alternative to gene target
  natural cytotoxicity triggering receptor 3, NCR3 and IDBG-78112 and ENSG00000204475 and 259197, protein binding, Plasma membranes, NCR3 and IDBG-634145 and ENSBTAG00000018343 and 513769

Gene info

• Identity
  HGNC:19077
• Gene
  NCR3
• Long gene name
  natural cytotoxicity triggering receptor 3
• Synonyms gene
  • LY117
• Synonyms gene name
  • lymphocyte antigen 117
• Synonyms
  • 1C7
  • NKp30
  • CD337
• GenBank acession
  • AB055881
• Locus
  6p21.33
• Discovery year
  2002-08-05
• Entrez gene record
  259197
• Pubmed identfication
  • 8824804
  • 11782277
• Classification
  • CD molecules
  • V-set domain containing
• VEGA ID
  OTTHUMG00000031123

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products